Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5095
Gene name
LocationContig_49:27371..31359
Strand+
Gene length (bp)3988
Transcript length (bp)2895
Coding sequence length (bp)2895
Protein length (aa) 965

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05024 Gpi1 N-acetylglucosaminyl transferase component (Gpi1) 1.9E-113 299 574
PF07986 TBCC Tubulin binding cofactor C 5.6E-27 800 915

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14357|GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi1 PE=2 SV=1 9 683 9.0E-128
sp|P53306|GPI1_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI1 PE=1 SV=1 292 677 4.0E-72
sp|Q9QYT7|PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus GN=Pigq PE=1 SV=3 381 618 7.0E-52
sp|Q9BRB3|PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens GN=PIGQ PE=1 SV=3 309 572 7.0E-43
sp|Q9SMR2|TBCC_ARATH Tubulin-folding cofactor C OS=Arabidopsis thaliana GN=TFCC PE=1 SV=1 798 929 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14357|GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi1 PE=2 SV=1 9 683 9.0E-128
sp|P53306|GPI1_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI1 PE=1 SV=1 292 677 4.0E-72
sp|Q9QYT7|PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus GN=Pigq PE=1 SV=3 381 618 7.0E-52
sp|Q9BRB3|PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens GN=PIGQ PE=1 SV=3 309 572 7.0E-43
sp|Q9SMR2|TBCC_ARATH Tubulin-folding cofactor C OS=Arabidopsis thaliana GN=TFCC PE=1 SV=1 798 929 2.0E-15
sp|Q3SZE9|TBCC_BOVIN Tubulin-specific chaperone C OS=Bos taurus GN=TBCC PE=2 SV=1 803 929 4.0E-13
sp|Q8VCN9|TBCC_MOUSE Tubulin-specific chaperone C OS=Mus musculus GN=Tbcc PE=1 SV=1 803 929 7.0E-13
sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C OS=Homo sapiens GN=TBCC PE=1 SV=2 803 929 2.0E-12
sp|Q5R5J7|TBCC_PONAB Tubulin-specific chaperone C OS=Pongo abelii GN=TBCC PE=2 SV=1 803 929 4.0E-12
sp|Q8AVX5|XRP2_XENLA Protein XRP2 OS=Xenopus laevis GN=rp2 PE=2 SV=3 826 929 1.0E-08
sp|Q5ZHN4|XRP2_CHICK Protein XRP2 OS=Gallus gallus GN=RP2 PE=2 SV=3 826 939 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:0006497 protein lipidation No
GO:0006505 GPI anchor metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006643 membrane lipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0006629 lipid metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0008150 biological_process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006793 phosphorus metabolic process No
GO:0036211 protein modification process No
GO:0006664 glycolipid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 247 269 22
2 339 361 22
3 403 425 22
4 432 451 19
5 466 488 22
6 509 531 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5095
MVEHDGLMRVFWPTDACGSHRPGVVVGWRNSTLDVFVVAVLDDADAQDVEFHLKLGSFFRGGPYNPCRIYDVCGH
ASMHVLGVSNAPLPETADPSWFRATTKPPLKRPTIACAKASSVQLILYDRPRPRRMQYISLEPIALALGDKSFRH
EDTKVDDEIEQQELKAKETRRKLVEKLKLHTIVHRVPSARDRALPKIINQVNWSWELEQTLQRNVGRLGPRPRRS
LSVSERVVESATTMRNYVLRRLWMLFTIYLFPVLWRGFCLLLFGHRMVAEVLLLALEFRPKPGGAALKDISATAQ
QIEIRLQQFCYWPMQYSTLRQRKKNWTSVTTSHPDYIRFYNSLWLVANDVIIGMALGSYIIEHADWVAAQMDDIL
RTYAVEALRRSISWLMGWPAGLKLNGELAAFLGDLFLWVIHYWSSCIEALQPVLPRLVWVIGFSSFAGASMPIAV
FSDLLSALTMHIYSFYLASARIYHWQLTILTSLFHLFRGKKHNVLRNRIDSCDYDLDQLLVGTIFFTLLSFLLPT
VVVFYLNFAVARMVIISIKAGFDTLLSCLNHFPLFALMLRIKDPRRLPGGIRFELRDDLEQKASEPKDDLEPPTS
VIYLKSIPLSLSAMFHQYFQMAHRIRKHYLSPGVLLRLLTGQFVPPINRKNLYSLQYSMLPAKRATAWEMWRALN
MEPQKKPFQLPPIPSLASGGKRMAGSGRVKVRVKVKPRRCGIGGPARTVTAINKGSPAPDGLITYEIPQPEPDTR
LHASSIMDPKQRFHRHFHESVAGLPSLPRNAHCDAKLTGATPVVEDQIVQLDLVNLRGCIVDMSVPTVQGRPFPG
LSLKGISNSLIVMGRVNGPVHITDVVDSVLVVIARQVRIHDCSNVDIYLYCGSHPIIEDCTGMRFAPLPKCYMTG
EESTMENQWDRVDDFKWLKAGHSPNWTTLSDGQTLGDDVWTKVVPGLPGASVEETLRRVGLPRE*
Coding >Ophun1|5095
ATGGTAGAACATGATGGGCTGATGCGAGTCTTCTGGCCGACGGACGCCTGCGGCTCACATCGGCCGGGCGTCGTC
GTTGGGTGGAGGAACTCGACGCTCGACGTCTTTGTCGTCGCTGTTCTCGACGACGCCGATGCTCAGGATGTCGAG
TTTCACCTCAAGCTCGGCTCCTTCTTCCGCGGCGGTCCCTATAACCCGTGTCGCATCTACGACGTCTGCGGCCAT
GCCTCAATGCACGTCTTGGGCGTCTCCAACGCGCCGCTTCCGGAGACGGCTGACCCGTCTTGGTTCCGCGCGACG
ACAAAGCCGCCCTTGAAGCGGCCGACCATCGCCTGCGCCAAGGCGTCGAGCGTCCAGCTTATCCTCTACGACAGA
CCGCGGCCCCGGCGCATGCAGTACATCTCGCTCGAGCCCATAGCCTTGGCTCTCGGTGACAAGAGCTTTCGCCAC
GAGGATACCAAGGTCGACGATGAGATTGAGCAGCAAGAACTCAAGGCAAAGGAAACGCGGCGCAAGCTGGTGGAG
AAGCTCAAACTGCACACCATCGTCCATCGCGTTCCCTCGGCCCGAGATAGGGCCTTGCCCAAGATCATCAACCAG
GTGAATTGGTCGTGGGAGCTGGAGCAGACGCTACAGAGAAACGTCGGCCGGCTGGGCCCGCGACCTCGGCGCAGC
CTCAGCGTCTCAGAGAGGGTGGTCGAGTCCGCGACGACGATGCGCAACTACGTCTTGCGCCGCCTGTGGATGCTC
TTCACTATATATCTGTTCCCGGTCCTGTGGCGAGGCTTCTGCCTGCTCCTCTTTGGCCACCGGATGGTCGCCGAA
GTGCTCCTGCTGGCGCTCGAGTTCCGCCCCAAGCCGGGAGGCGCCGCTCTCAAGGACATCTCGGCCACAGCTCAG
CAGATCGAAATCCGGTTGCAGCAGTTCTGCTACTGGCCCATGCAGTACTCGACGCTGCGCCAACGCAAGAAGAAC
TGGACCAGCGTCACCACTAGCCATCCCGACTACATTCGCTTCTACAACAGCTTGTGGCTGGTTGCCAACGATGTC
ATCATCGGCATGGCGCTCGGCTCCTACATCATCGAGCACGCAGACTGGGTGGCGGCCCAGATGGACGATATCCTG
AGGACCTATGCCGTCGAGGCCCTCCGGCGCAGCATCTCATGGCTCATGGGTTGGCCCGCCGGTCTCAAGCTCAAT
GGCGAGCTCGCAGCCTTTCTGGGTGACCTGTTTCTCTGGGTCATTCACTACTGGTCCAGCTGCATTGAGGCGCTG
CAGCCGGTCTTGCCGCGTCTAGTATGGGTCATAGGATTCTCCTCGTTCGCCGGCGCCAGCATGCCCATCGCCGTC
TTTTCCGACTTGCTATCGGCCTTGACGATGCACATCTACTCGTTCTATCTAGCCTCGGCACGCATCTACCACTGG
CAGCTCACCATCCTGACATCGCTGTTCCACCTGTTCCGCGGCAAGAAGCACAACGTGCTCCGCAATCGTATCGAC
TCGTGCGACTACGACCTGGACCAGCTGCTCGTTGGCACCATCTTCTTCACCCTGCTCTCGTTTTTGCTGCCTACG
GTGGTTGTCTTCTACCTTAATTTCGCCGTGGCCAGGATGGTCATCATCTCCATCAAAGCCGGCTTTGACACGCTT
CTATCGTGTCTCAACCACTTTCCGCTCTTTGCCCTGATGCTGCGGATTAAAGACCCGAGACGACTGCCAGGCGGC
ATTCGCTTCGAACTCCGGGACGATCTCGAGCAAAAGGCGTCCGAGCCCAAGGACGATCTCGAGCCGCCAACCTCG
GTCATCTACCTCAAGTCGATCCCCCTATCGCTGAGCGCCATGTTCCATCAATACTTCCAGATGGCACACCGGATC
CGCAAGCACTACCTCTCGCCCGGGGTACTACTTCGGCTACTGACGGGCCAGTTCGTGCCGCCCATCAACAGGAAG
AACCTGTATAGCTTGCAGTACAGCATGCTGCCGGCCAAGAGGGCGACGGCGTGGGAGATGTGGCGGGCGCTCAAC
ATGGAGCCCCAGAAGAAGCCATTTCAGCTGCCGCCAATACCGTCGCTGGCGAGCGGGGGCAAGCGGATGGCGGGG
AGTGGACGGGTGAAGGTGAGGGTGAAGGTGAAGCCTCGGAGATGCGGCATCGGCGGACCGGCGCGGACCGTGACG
GCCATCAACAAGGGCAGCCCCGCACCGGACGGCCTGATTACGTACGAGATCCCTCAGCCAGAACCCGACACTCGT
CTCCATGCCTCCTCCATCATGGATCCCAAGCAGCGGTTCCACAGACACTTCCACGAGAGCGTCGCCGGTTTGCCT
TCCCTTCCCCGGAATGCCCATTGCGATGCTAAGCTTACGGGGGCGACGCCAGTGGTCGAGGACCAGATCGTACAG
CTAGACTTGGTTAATCTGCGCGGGTGCATCGTCGACATGTCGGTTCCGACGGTCCAGGGGAGGCCGTTTCCGGGG
CTGTCGCTCAAGGGTATCAGCAACAGCCTGATTGTGATGGGTCGGGTGAACGGACCGGTTCATATTACCGATGTG
GTCGACAGTGTTCTTGTCGTCATTGCGCGCCAGGTTCGGATTCATGACTGCAGCAATGTCGATATTTACCTTTAC
TGCGGAAGCCATCCCATCATCGAGGACTGTACCGGCATGCGGTTCGCGCCGCTGCCAAAGTGTTATATGACGGGG
GAAGAATCGACGATGGAGAATCAGTGGGATCGGGTTGACGACTTTAAATGGCTCAAGGCGGGACACAGCCCCAAC
TGGACGACGCTTTCTGACGGTCAGACGCTTGGTGACGACGTCTGGACGAAAGTGGTGCCGGGATTGCCGGGGGCG
AGTGTGGAGGAGACGCTGAGGAGGGTTGGACTGCCGAGAGAGTGA
Transcript >Ophun1|5095
ATGGTAGAACATGATGGGCTGATGCGAGTCTTCTGGCCGACGGACGCCTGCGGCTCACATCGGCCGGGCGTCGTC
GTTGGGTGGAGGAACTCGACGCTCGACGTCTTTGTCGTCGCTGTTCTCGACGACGCCGATGCTCAGGATGTCGAG
TTTCACCTCAAGCTCGGCTCCTTCTTCCGCGGCGGTCCCTATAACCCGTGTCGCATCTACGACGTCTGCGGCCAT
GCCTCAATGCACGTCTTGGGCGTCTCCAACGCGCCGCTTCCGGAGACGGCTGACCCGTCTTGGTTCCGCGCGACG
ACAAAGCCGCCCTTGAAGCGGCCGACCATCGCCTGCGCCAAGGCGTCGAGCGTCCAGCTTATCCTCTACGACAGA
CCGCGGCCCCGGCGCATGCAGTACATCTCGCTCGAGCCCATAGCCTTGGCTCTCGGTGACAAGAGCTTTCGCCAC
GAGGATACCAAGGTCGACGATGAGATTGAGCAGCAAGAACTCAAGGCAAAGGAAACGCGGCGCAAGCTGGTGGAG
AAGCTCAAACTGCACACCATCGTCCATCGCGTTCCCTCGGCCCGAGATAGGGCCTTGCCCAAGATCATCAACCAG
GTGAATTGGTCGTGGGAGCTGGAGCAGACGCTACAGAGAAACGTCGGCCGGCTGGGCCCGCGACCTCGGCGCAGC
CTCAGCGTCTCAGAGAGGGTGGTCGAGTCCGCGACGACGATGCGCAACTACGTCTTGCGCCGCCTGTGGATGCTC
TTCACTATATATCTGTTCCCGGTCCTGTGGCGAGGCTTCTGCCTGCTCCTCTTTGGCCACCGGATGGTCGCCGAA
GTGCTCCTGCTGGCGCTCGAGTTCCGCCCCAAGCCGGGAGGCGCCGCTCTCAAGGACATCTCGGCCACAGCTCAG
CAGATCGAAATCCGGTTGCAGCAGTTCTGCTACTGGCCCATGCAGTACTCGACGCTGCGCCAACGCAAGAAGAAC
TGGACCAGCGTCACCACTAGCCATCCCGACTACATTCGCTTCTACAACAGCTTGTGGCTGGTTGCCAACGATGTC
ATCATCGGCATGGCGCTCGGCTCCTACATCATCGAGCACGCAGACTGGGTGGCGGCCCAGATGGACGATATCCTG
AGGACCTATGCCGTCGAGGCCCTCCGGCGCAGCATCTCATGGCTCATGGGTTGGCCCGCCGGTCTCAAGCTCAAT
GGCGAGCTCGCAGCCTTTCTGGGTGACCTGTTTCTCTGGGTCATTCACTACTGGTCCAGCTGCATTGAGGCGCTG
CAGCCGGTCTTGCCGCGTCTAGTATGGGTCATAGGATTCTCCTCGTTCGCCGGCGCCAGCATGCCCATCGCCGTC
TTTTCCGACTTGCTATCGGCCTTGACGATGCACATCTACTCGTTCTATCTAGCCTCGGCACGCATCTACCACTGG
CAGCTCACCATCCTGACATCGCTGTTCCACCTGTTCCGCGGCAAGAAGCACAACGTGCTCCGCAATCGTATCGAC
TCGTGCGACTACGACCTGGACCAGCTGCTCGTTGGCACCATCTTCTTCACCCTGCTCTCGTTTTTGCTGCCTACG
GTGGTTGTCTTCTACCTTAATTTCGCCGTGGCCAGGATGGTCATCATCTCCATCAAAGCCGGCTTTGACACGCTT
CTATCGTGTCTCAACCACTTTCCGCTCTTTGCCCTGATGCTGCGGATTAAAGACCCGAGACGACTGCCAGGCGGC
ATTCGCTTCGAACTCCGGGACGATCTCGAGCAAAAGGCGTCCGAGCCCAAGGACGATCTCGAGCCGCCAACCTCG
GTCATCTACCTCAAGTCGATCCCCCTATCGCTGAGCGCCATGTTCCATCAATACTTCCAGATGGCACACCGGATC
CGCAAGCACTACCTCTCGCCCGGGGTACTACTTCGGCTACTGACGGGCCAGTTCGTGCCGCCCATCAACAGGAAG
AACCTGTATAGCTTGCAGTACAGCATGCTGCCGGCCAAGAGGGCGACGGCGTGGGAGATGTGGCGGGCGCTCAAC
ATGGAGCCCCAGAAGAAGCCATTTCAGCTGCCGCCAATACCGTCGCTGGCGAGCGGGGGCAAGCGGATGGCGGGG
AGTGGACGGGTGAAGGTGAGGGTGAAGGTGAAGCCTCGGAGATGCGGCATCGGCGGACCGGCGCGGACCGTGACG
GCCATCAACAAGGGCAGCCCCGCACCGGACGGCCTGATTACGTACGAGATCCCTCAGCCAGAACCCGACACTCGT
CTCCATGCCTCCTCCATCATGGATCCCAAGCAGCGGTTCCACAGACACTTCCACGAGAGCGTCGCCGGTTTGCCT
TCCCTTCCCCGGAATGCCCATTGCGATGCTAAGCTTACGGGGGCGACGCCAGTGGTCGAGGACCAGATCGTACAG
CTAGACTTGGTTAATCTGCGCGGGTGCATCGTCGACATGTCGGTTCCGACGGTCCAGGGGAGGCCGTTTCCGGGG
CTGTCGCTCAAGGGTATCAGCAACAGCCTGATTGTGATGGGTCGGGTGAACGGACCGGTTCATATTACCGATGTG
GTCGACAGTGTTCTTGTCGTCATTGCGCGCCAGGTTCGGATTCATGACTGCAGCAATGTCGATATTTACCTTTAC
TGCGGAAGCCATCCCATCATCGAGGACTGTACCGGCATGCGGTTCGCGCCGCTGCCAAAGTGTTATATGACGGGG
GAAGAATCGACGATGGAGAATCAGTGGGATCGGGTTGACGACTTTAAATGGCTCAAGGCGGGACACAGCCCCAAC
TGGACGACGCTTTCTGACGGTCAGACGCTTGGTGACGACGTCTGGACGAAAGTGGTGCCGGGATTGCCGGGGGCG
AGTGTGGAGGAGACGCTGAGGAGGGTTGGACTGCCGAGAGAGTGA
Gene >Ophun1|5095
ATGGTAGAACATGATGGGCTGATGCGAGTCTTCTGGCCGACGGACGCCTGCGGCTCACATCGGCCGGGCGTCGTC
GTTGGGTGGAGGAACTCGACGCTCGACGTCTTTGTCGTCGCTGTTCTCGACGACGCCGATGTCTGTTGCCACTGC
TCTGTTGCGCGTCTCGTTACTCATTGCTGATCGTCAGACCACAGGCTCAGGATGTCGAGTTTCACCTCAAGCTCG
GCTCCTTCTTCCGCGGCGGTCCCTATAACCCGTGTCGCATCTACGACGTCTGCGGCCATGCCTCAATGCACGTCT
TGGGCGTCTCCAACGCGCCGCTTCCGGAGACGGCTGACCCGTCTTGGTTCCGCGCGACGACAAAGCCGCCCTTGA
AGCGGCCGACCATCGCCTGCGCCAAGGCGTCGAGCGTCCAGCTTATCCTCTACGACAGACCGCGGCCCCGGCGCA
TGCAGTACATCTCGCTCGAGCCCATAGCCTTGGCTCTCGGTGACAAGAGCTTTCGCCACGAGGATACCAAGGTCG
ACGATGAGATTGAGCAGCAAGAACTCAAGGCAAAGGAAACGCGGCGCAAGCTGGTGGAGAAGCTCAAACTGCACA
CCATCGTCCATCGCGTTCCCTCGGCCCGAGATAGGGCCTTGCCCAAGATCATCAACCAGGTGAATTGGTCGTGGG
AGCTGGAGCAGACGCTACAGAGAAACGTCGGCCGGCTGGGCCCGCGACCTCGGCGCAGCCTCAGCGTCTCAGAGA
GGGTGGTCGAGTCCGCGACGACGATGCGCAACTACGTCTTGCGCCGCCTGTGGATGCTCTTCACTATATATCTGT
TCCCGGTCCTGTGGCGAGGCTTCTGCCTGCTCCTCTTTGGCCACCGGATGGTCGCCGAAGTGCTCCTGCTGGCGC
TCGAGTTCCGCCCCAAGCCGGGAGGCGCCGCTCTCAAGGACATCTCGGCCACAGCTCAGCAGATCGAAATCCGGT
TGCAGCAGTTCTGCTACTGGCCCATGCAGTACTCGACGCTGCGCCAACGCAAGAAGAACTGGACCAGCGTCACCA
CTAGCCATCCCGACTACATTCGCTTCTACAACAGCTTGTGGCTGGTTGCCAACGATGTCATCATCGGCATGGCGC
TCGGCTCCTACATCATCGAGCACGCAGACTGGGTGGCGGCCCAGATGGACGATATCCTGAGGACCTATGCCGTCG
AGGCCCTCCGGCGCAGCATCTCATGGCTCATGGGTTGGCCCGCCGGTCTCAAGCTCAATGGCGAGCTCGCAGCCT
TTCTGGGTGACCTGTTTCTCTGGGTCATTCACTACTGGTCCAGTATGTTGACCATTTCCCACTATGCTTCTGGTT
CTGCGTCAGCTAAAAGGGGCAACAGGCTGCATTGAGGCGCTGCAGCCGGTCTTGCCGCGTCTAGTATGGGTCATA
GGATTCTCCTCGTTCGCCGGCGCCAGCATGCCCATCGCCGTCTTTTCCGACTTGCTATCGGCCTTGACGATGCAC
ATCTACTCGTTCTATCTAGCCTCGGCACGCATCTACCACTGGCAGCTCACCATCCTGACATCGCTGTTCCACCTG
TTCCGCGGCAAGAAGCACAACGTGCTCCGCAATCGTATCGACTCGTGCGACTACGACCTGGACCAGCTGCTCGTT
GGCACCATCTTCTTCACCCTGCTCTCGTTTTTGCTGCCTACGGTGGTTGTCTTCTACCTTAATTTCGCCGTGGCC
AGGATGGTCATCATCTCCATCAAAGCCGGCTTTGACACGCTTCTATCGTGTCTCAACCACTTTCCGCTCTTTGCC
CTGATGCTGCGGATTAAAGACCCGAGACGACTGCCAGGTGAGTCGAAATTGGAAAAGTGTGCTAAGTAAGGGGAC
TGATGACATGGCCAGGCGGCATTCGCTTCGAACTCCGGGACGATCTCGAGCAAAAGGCGTCCGAGCCCAAGGACG
ATCTCGAGCCGCCAACCTCGGTCATCTACCTCAAGGTTAGTAAAAACCTCGCTGACGTCGCGGCCGTGCTCCATG
GCTGACAAGGCGCAGTCGATCCCCCTATCGCTGAGCGCCATGTTCCATCAATACTTCCAGATGGCACACCGGATC
CGCAAGCACTACCTCTCGCCCGGGGTACTACTTCGGCTACTGACGGGCCAGTTCGTGCCGCCCATCAACAGGAAG
AACCTGTATAGCTTGCAGTACAGCATGCTGCCGGCCAAGAGGGCGACGGCGTGGGAGATGTGGCGGGCGCTCAAC
ATGGAGCCCCAGAAGAAGCCATTTCAGCTGCCGCCAATACCGTCGCTGGCGAGCGGGGGCAAGCGGATGGCGGGG
AGTGGACGGTCGAGGTCGCATCATTAGATGGCGGCTCGGGGCAACATGTAGGTATCTTTGGCGTTGGGGACAAGC
GGAGGAATGGCCTGGAGTCGGGGGAAATCACGTGTAAGCGAATCAGAGGGGATTTCTACCGTTTTGTCCGTCTCG
CTCCCTTTGTGACTTTGTGAGGGTGAAGGTGAGGGTGAAGGTGAAGCCTCGGAGATGCGGCATCGGCGGACCGGC
GCGGACCGTGACGGCCATCAACAAGGGCAGCCCCGCACCGGACGGCCTGATTACGTACGAGATCCGTTGGTCGAG
CCCCTCACCTGATCTCATCTCTTCCTCATCGGCCCATGGCCTTGACGTAACATCTAGCTCAGCCAGAACCCGACA
CTCGTCTCCATGCCTCCTCCATCATGGATCCCAAGCAGCGGTTCCACAGACACTTCCACGAGAGCGTCGCCGGTT
TGCCTTCCCTTCCCCGGAATGCCCATTGCGATGCTAAGCTTACGGGGGCGACGCCAGTGGTCGAGGACCAGATCG
TACAGCTAGAGTCCGTCTCTGCGGTTGCGGGAGAGCGGCAGGAGGCTATCGATCATGTGCTCGCGGGCATCGCGC
AGATACAGAACTCGGTTACGGACGCGGCTGATTATACGCCTTCGTATGATCGGAGGCAATATGCTGAGGTGTGTT
TGCTATGCCCCGGGGGGAGGAGAAGATGAAGTGTTTATGCGGTTCAAGGCAGACTGTCAAATCGCTACATGACAA
ATTGAACGAGACGGTCACGAGGGTGAAGCCCAAATCTCGGTTTCAATTTAGGAGGTCTGTCGACGATGGCGTCCA
TGTCGATATGGGTGCTCCCGAGAACGACCCGCGCTTGAACCCTGGGAGCCTTTCGAGAAAGACTGGTAGGGCGAC
GGGGAGCGCGGTGGACGAGGGGGGGGACACCGTTGGAGACTTGCCGGTGGGCACGACGACGGCGGCGGCGGCAGG
CAGAGATTATAACCTTGAACTCTCGCAGCCTGGGGCTTCGGGGATTCGGAAGCCGAGTTTCTCGACGGCTAGCAC
TATTGGGATTTCGAACCAGACGGGTTTGCATATTATATTGCCTTCGTCGGCTGCTCGTGCCACGGCTTCTGGCAG
CTTGGTTAATCTGCGCGGGTGCATCGTCGACATGTCGGTTCCGACGGTCCAGGGGAGGCCGTTTCCGGGGCTGTC
GCTCAAGGGTATCAGCAACAGCCTGATTGTGATGGGTCGGGTGAACGGACCGGTTCATATTACCGATGTGGTCGA
CAGTGTTCTTGTCGTCATTGCGCGCCAGGTTCGGATTCATGACTGCAGCAATGTCGATATTTACCTTTACTGCGG
AAGCCATCCCATCATCGAGGACTGTACCGGCATGCGGTTCGCGCCGCTGCCAAAGTGTTATGTGAGGAGTTGTCG
AGCCTGAAAGAAGAAGACGCTGACGAGGATGCAGATGACGGGGGAAGAATCGACGATGGAGAATCAGTGGGATCG
GGTTGACGACTTTAAATGGCTCAAGGCGGGACACAGCCCCAACTGGACGACGCTTTCTGACGGTCAGACGCTTGG
TGACGACGTCTGGACGAAAGTGGTGCCGGGATTGCCGGGGGCGAGTGTGGAGGAGACGCTGAGGAGGGTTGGACT
GCCGAGAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail