Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|509
Gene name
LocationContig_115:13087..14736
Strand-
Gene length (bp)1649
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-40 46 442
PF00083 Sugar_tr Sugar (and other) transporter 5.2E-18 46 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 24 533 5.0E-63
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 1 527 2.0E-48
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 46 530 8.0E-43
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 48 502 2.0E-39
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 49 458 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 24 533 5.0E-63
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 1 527 2.0E-48
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 46 530 8.0E-43
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 48 502 2.0E-39
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 49 458 2.0E-38
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 49 458 2.0E-38
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 17 458 3.0E-35
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 51 532 8.0E-35
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 37 533 2.0E-34
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 73 519 2.0E-34
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 13 533 3.0E-34
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 48 506 7.0E-33
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 10 480 3.0E-31
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 47 456 5.0E-29
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 50 389 2.0E-25
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 50 389 2.0E-25
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 55 456 5.0E-21
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 47 452 5.0E-20
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 51 361 2.0E-17
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 51 361 3.0E-17
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 129 480 1.0E-16
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 48 366 9.0E-16
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 49 452 7.0E-15
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 55 203 1.0E-14
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 50 449 7.0E-14
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 23 346 1.0E-13
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 23 346 1.0E-13
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 50 345 1.0E-13
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 51 389 2.0E-13
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 50 346 2.0E-13
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 54 457 3.0E-13
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 48 448 3.0E-13
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 48 448 3.0E-13
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 48 448 3.0E-13
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 48 448 3.0E-13
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 48 448 3.0E-13
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 48 448 3.0E-13
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 48 448 3.0E-13
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 48 448 3.0E-13
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 49 450 5.0E-13
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 250 475 6.0E-13
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 50 345 5.0E-12
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 50 451 6.0E-12
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 50 381 6.0E-12
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 50 352 1.0E-11
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 50 381 1.0E-11
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 50 352 1.0E-11
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 50 381 1.0E-11
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 37 472 1.0E-11
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 37 472 1.0E-11
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 49 361 2.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 50 352 2.0E-11
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 50 381 2.0E-11
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 50 381 2.0E-11
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 50 352 2.0E-11
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 51 456 2.0E-11
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 51 339 3.0E-11
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 50 345 3.0E-11
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 4 485 3.0E-11
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 50 381 3.0E-11
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 50 381 3.0E-11
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 50 381 3.0E-11
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 50 381 3.0E-11
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 50 345 4.0E-11
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 50 381 5.0E-11
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 50 365 5.0E-11
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 12 521 6.0E-11
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 50 457 9.0E-11
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 50 457 9.0E-11
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 12 521 1.0E-10
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 50 381 1.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 50 369 2.0E-10
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 50 352 2.0E-10
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 48 449 3.0E-10
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 54 463 4.0E-10
sp|Q04602|VBA4_YEAST Vacuolar basic amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA4 PE=1 SV=1 17 209 1.0E-09
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 46 476 5.0E-09
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 1 518 5.0E-09
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 52 500 2.0E-08
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 3 504 3.0E-08
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 94 219 4.0E-08
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 50 352 4.0E-08
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 50 458 5.0E-08
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 94 219 5.0E-08
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 48 331 5.0E-08
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 51 364 5.0E-08
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 50 352 5.0E-08
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 77 298 5.0E-08
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 50 352 6.0E-08
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 50 352 6.0E-08
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 50 352 7.0E-08
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 50 352 7.0E-08
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 50 352 7.0E-08
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 50 352 7.0E-08
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 50 352 7.0E-08
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 50 352 8.0E-08
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 50 352 8.0E-08
sp|Q8NLB7|GENK_CORGL Gentisate transporter OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=genK PE=1 SV=2 7 232 9.0E-08
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 77 381 9.0E-08
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 77 340 1.0E-07
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 48 458 1.0E-07
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 50 352 1.0E-07
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 50 352 1.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 77 340 1.0E-07
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 50 352 2.0E-07
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 50 352 2.0E-07
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 50 352 2.0E-07
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 9 499 2.0E-07
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 50 352 2.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 50 352 3.0E-07
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 94 219 3.0E-07
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 50 352 5.0E-07
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 94 219 6.0E-07
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 93 219 9.0E-07
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 49 488 1.0E-06
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 50 352 2.0E-06
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 93 227 2.0E-06
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 94 219 3.0E-06
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 95 219 4.0E-06
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 50 499 5.0E-06
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 39 383 6.0E-06
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 50 352 8.0E-06
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 77 361 8.0E-06
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 49 488 8.0E-06
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 94 234 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 75 97 22
3 104 126 22
4 130 152 22
5 164 186 22
6 196 218 22
7 231 253 22
8 263 281 18
9 302 324 22
10 334 356 22
11 363 382 19
12 397 419 22
13 432 454 22
14 500 522 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|509
MSDNNSTPICPETASLLSKTTTDEERTIIVKDVSLARLALTMSTAWSSVFLAALDSTIVATLSAPISSEFHSLSL
FSWLATGYFISTAACQPISGRLTDIFGRGPGLAFCNLVFAAGNLICGLAGNQYVIIVGRVVAGIGGGGLLSIATF
LASDLIPLRQRGLIGAIGNLWFGVGCMTGGVVGGILNDYTAMGWRLAFLIQVPPSILSAIAVTLLVKVPPKQSDR
SHLARIDFVGVFLTSSFLVLLVFGLNAGGNLTPWAHPLPITSLLLSFLLFILFIWWESRARQPIIPVKLLLDRTV
SCACLTSLVVAMLANTAIFFVPLYLQILGETATSAGLRMLSSPVGMAFGALGSGYLMRRTGKFVGLGMASVLLLL
VGAVLLCLQSQDTPATLTTAAFFFIGAGYSAVLSVTQIACIAAVDHSQQAVVTSITFLGRSLGGTAGITIVSAIY
QNTLDSRLWWRFGGEPDAEAIIGRLRNDIGQLRHVPAEWRPGVVASFSEAFRYVWLTVLAWALLAIVCVSPIKQH
KLHSSLDRK*
Coding >Ophun1|509
ATGAGCGACAACAACTCTACCCCGATATGCCCCGAAACAGCAAGCCTCCTCTCCAAGACAACCACGGACGAAGAG
CGAACCATCATCGTCAAGGATGTCTCCCTCGCCAGGCTCGCCCTCACCATGAGCACCGCCTGGTCCAGCGTCTTC
CTCGCCGCCCTCGACTCCACCATCGTCGCCACGCTATCGGCCCCCATCTCGAGCGAGTTCCACTCCCTCAGCCTC
TTCTCATGGCTCGCCACCGGGTATTTCATCTCGACGGCTGCCTGCCAGCCTATTTCGGGTCGTCTGACCGACATC
TTTGGCCGCGGACCCGGTCTCGCCTTTTGCAACCTTGTCTTCGCGGCTGGCAATCTTATCTGCGGCCTAGCTGGG
AACCAGTATGTCATCATCGTCGGACGTGTCGTTGCGGGTATCGGCGGCGGCGGTCTTCTTAGCATCGCTACTTTT
CTCGCCTCGGATCTGATACCCCTGAGGCAACGCGGCCTTATCGGAGCCATCGGCAACCTCTGGTTCGGCGTTGGG
TGTATGACTGGCGGTGTTGTAGGCGGCATTCTCAACGACTATACGGCTATGGGCTGGCGACTTGCCTTTCTGATT
CAAGTCCCTCCCTCGATACTGTCTGCTATAGCCGTGACGCTGCTGGTCAAGGTGCCGCCGAAGCAGTCTGACCGG
TCTCACCTTGCTAGGATCGACTTTGTCGGTGTTTTCCTGACTTCGTCCTTTCTTGTGCTTCTCGTCTTTGGCCTC
AATGCGGGAGGGAACCTGACTCCATGGGCTCACCCTCTGCCCATCACCAGCCTACTACTCTCTTTTCTGCTATTC
ATCCTCTTTATCTGGTGGGAAAGCAGGGCTCGACAACCTATTATACCCGTCAAGCTGCTCCTAGACCGCACCGTT
TCGTGTGCCTGTCTAACAAGCCTCGTCGTTGCCATGCTGGCAAACACAGCCATCTTCTTCGTCCCGCTCTACCTG
CAGATCCTCGGCGAGACGGCCACCAGCGCCGGTCTCAGGATGCTATCGTCGCCCGTCGGCATGGCCTTTGGAGCT
CTCGGCTCGGGCTACCTGATGAGACGGACGGGCAAGTTTGTTGGGCTGGGCATGGCCAGCGTTCTACTGCTGCTG
GTGGGAGCCGTGCTGCTGTGTCTGCAGAGTCAGGACACGCCGGCTACGCTGACGACGGCCGCCTTCTTCTTCATA
GGGGCTGGCTATAGCGCGGTGCTGTCGGTGACGCAGATTGCCTGCATTGCGGCCGTCGATCACTCGCAACAGGCC
GTCGTCACGTCTATTACATTCCTCGGCCGGAGCCTGGGCGGAACCGCAGGCATCACCATCGTGTCGGCCATCTAT
CAGAACACGCTCGACTCCCGGCTCTGGTGGCGCTTCGGTGGCGAGCCTGACGCGGAGGCCATCATCGGCCGGCTG
CGGAACGACATTGGACAGCTGCGACATGTGCCGGCTGAGTGGCGCCCGGGCGTGGTGGCATCCTTTTCCGAAGCC
TTTCGCTATGTCTGGTTGACTGTGCTCGCCTGGGCGCTGCTGGCCATCGTCTGTGTTTCTCCCATCAAGCAGCAT
AAACTGCACTCGTCGCTGGACAGGAAATGA
Transcript >Ophun1|509
ATGAGCGACAACAACTCTACCCCGATATGCCCCGAAACAGCAAGCCTCCTCTCCAAGACAACCACGGACGAAGAG
CGAACCATCATCGTCAAGGATGTCTCCCTCGCCAGGCTCGCCCTCACCATGAGCACCGCCTGGTCCAGCGTCTTC
CTCGCCGCCCTCGACTCCACCATCGTCGCCACGCTATCGGCCCCCATCTCGAGCGAGTTCCACTCCCTCAGCCTC
TTCTCATGGCTCGCCACCGGGTATTTCATCTCGACGGCTGCCTGCCAGCCTATTTCGGGTCGTCTGACCGACATC
TTTGGCCGCGGACCCGGTCTCGCCTTTTGCAACCTTGTCTTCGCGGCTGGCAATCTTATCTGCGGCCTAGCTGGG
AACCAGTATGTCATCATCGTCGGACGTGTCGTTGCGGGTATCGGCGGCGGCGGTCTTCTTAGCATCGCTACTTTT
CTCGCCTCGGATCTGATACCCCTGAGGCAACGCGGCCTTATCGGAGCCATCGGCAACCTCTGGTTCGGCGTTGGG
TGTATGACTGGCGGTGTTGTAGGCGGCATTCTCAACGACTATACGGCTATGGGCTGGCGACTTGCCTTTCTGATT
CAAGTCCCTCCCTCGATACTGTCTGCTATAGCCGTGACGCTGCTGGTCAAGGTGCCGCCGAAGCAGTCTGACCGG
TCTCACCTTGCTAGGATCGACTTTGTCGGTGTTTTCCTGACTTCGTCCTTTCTTGTGCTTCTCGTCTTTGGCCTC
AATGCGGGAGGGAACCTGACTCCATGGGCTCACCCTCTGCCCATCACCAGCCTACTACTCTCTTTTCTGCTATTC
ATCCTCTTTATCTGGTGGGAAAGCAGGGCTCGACAACCTATTATACCCGTCAAGCTGCTCCTAGACCGCACCGTT
TCGTGTGCCTGTCTAACAAGCCTCGTCGTTGCCATGCTGGCAAACACAGCCATCTTCTTCGTCCCGCTCTACCTG
CAGATCCTCGGCGAGACGGCCACCAGCGCCGGTCTCAGGATGCTATCGTCGCCCGTCGGCATGGCCTTTGGAGCT
CTCGGCTCGGGCTACCTGATGAGACGGACGGGCAAGTTTGTTGGGCTGGGCATGGCCAGCGTTCTACTGCTGCTG
GTGGGAGCCGTGCTGCTGTGTCTGCAGAGTCAGGACACGCCGGCTACGCTGACGACGGCCGCCTTCTTCTTCATA
GGGGCTGGCTATAGCGCGGTGCTGTCGGTGACGCAGATTGCCTGCATTGCGGCCGTCGATCACTCGCAACAGGCC
GTCGTCACGTCTATTACATTCCTCGGCCGGAGCCTGGGCGGAACCGCAGGCATCACCATCGTGTCGGCCATCTAT
CAGAACACGCTCGACTCCCGGCTCTGGTGGCGCTTCGGTGGCGAGCCTGACGCGGAGGCCATCATCGGCCGGCTG
CGGAACGACATTGGACAGCTGCGACATGTGCCGGCTGAGTGGCGCCCGGGCGTGGTGGCATCCTTTTCCGAAGCC
TTTCGCTATGTCTGGTTGACTGTGCTCGCCTGGGCGCTGCTGGCCATCGTCTGTGTTTCTCCCATCAAGCAGCAT
AAACTGCACTCGTCGCTGGACAGGAAATGA
Gene >Ophun1|509
ATGAGCGACAACAACTCTACCCCGATATGCCCCGAAACAGCAAGCCTCCTCTCCAAGACAACCACGGACGAAGAG
CGAACCATCATCGTCAAGGATGTCTCCCTCGCCAGGCTCGCCCTCACCATGAGCACCGCCTGGTCCAGCGTCTTC
CTCGCCGCCCTCGACTCCACCATCGTCGCCACGCTATCGGCCCCCATCTCGAGCGAGTTCCACTCCCTCAGCCTC
TTCTCATGGCTCGCCACCGGGTATTTCATCTCGACGGCTGCCTGCCAGCCTATTTCGGGTCGTCTGACCGACATC
TTTGGCCGCGGACCCGGTCTCGCCTTTTGCAACCTTGTCTTCGCGGCTGGCAATCTTATCTGCGGCCTAGCTGGG
AACCAGTATGTCATCATCGTCGGACGTGTCGTTGCGGGTATCGGCGGCGGCGGTCTTCTTAGCATCGCTACTTTT
CTCGCCTCGGATCTGATACCCCTGAGGCAACGCGGCCTTATCGGAGCCATCGGCAACCTCTGGTTCGGCGTTGGG
TGTATGACTGGCGGTGTTGTAGGCGGCATTCTCAACGACTATACGGCTATGGGCTGGCGACTTGCCTTTCTGATT
CAAGTCCCTCCCTCGATACTGTCTGCTATAGCCGTGACGCTGCTGGTCAAGGTGCCGCCGAAGCAGTCTGACCGG
TCTCACCTTGCTAGGATCGACTTTGTCGGTGTTTTCCTGACTTCGTCCTTTCTTGTGCTTCTCGTCTTTGGCCTC
AATGCGGGAGGGAACCTGACTCCATGGGCTCACCCTCTGCCCATCACCAGCCTACTACTCTCTTTTCTGCTATTC
ATCCTCTTTATCTGGTGGGAAAGCAGGGCTCGACAACCTATTATACCCGTCAAGCTGCTCCTAGACCGCACCGTT
TCGTGTGCCTGTCTAACAAGCCTCGTCGTTGCCATGCTGGCAAACACAGCCATCTTCTTCGTCCCGCTCTACCTG
CAGATCCTCGGCGAGACGGCCACCAGCGCCGGTCTCAGGATGCTATCGTCGCCCGTCGGCATGGCCTTTGGAGCT
CTCGGCTCGGGCTACCTGATGAGACGGACGGGCAAGTTTGTTGGGCTGGGCATGGCCAGCGTTCTACTGCTGCTG
GTGGGAGCCGTGCTGCTGTGTCTGCAGAGTCAGGACACGCCGGCTACGCTGACGACGGCCGCCTTCTTCTTCATA
GGGGCTGGCTATAGCGCGGTGCTGTCGGTGACGCAGATTGCCTGCATTGCGGCCGTCGATCACTCGCAACAGGCC
GTCGTCACGTCTATTACATGTAAGTGTCCCAACCCTAAGAGATACAGCAGCTGATGGCCACAGTCCTCGGCCGGA
GCCTGGGCGGAACCGCAGGCATCACCATCGTGTCGGCCATCTATCAGAACACGCTCGACTCCCGGCTCTGGTGGC
GCTTCGGTGGCGAGCCTGACGCGGAGGCCATCATCGGCCGGCTGCGGAACGACATTGGACAGCTGCGACATGTGC
CGGCTGAGTGGCGCCCGGGCGTGGTGGCATCCTTTTCCGAAGCCTTTCGCTATGTCTGGTTGACTGTGCTCGCCT
GGGCGCTGCTGGCCATCGTCTGTGTTTCTCCCATCAAGCAGCATAAACTGCACTCGTCGCTGGACAGGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail