Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5086
Gene name
LocationContig_49:15995..17193
Strand-
Gene length (bp)1198
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03959 FSH1 Serine hydrolase (FSH1) 2.9E-29 2 218
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.5E-06 3 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 237 4.0E-20
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 231 2.0E-17
sp|Q9D7E3|OVCA2_MOUSE Ovarian cancer-associated gene 2 protein homolog OS=Mus musculus GN=Ovca2 PE=1 SV=1 1 229 5.0E-09
sp|A4II73|OVCA2_XENTR Ovarian cancer-associated gene 2 protein homolog OS=Xenopus tropicalis GN=ovca2 PE=2 SV=2 1 216 6.0E-09
sp|Q3SZ07|OVCA2_BOVIN Ovarian cancer-associated gene 2 protein homolog OS=Bos taurus GN=OVCA2 PE=2 SV=1 1 216 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 237 4.0E-20
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 231 2.0E-17
sp|Q9D7E3|OVCA2_MOUSE Ovarian cancer-associated gene 2 protein homolog OS=Mus musculus GN=Ovca2 PE=1 SV=1 1 229 5.0E-09
sp|A4II73|OVCA2_XENTR Ovarian cancer-associated gene 2 protein homolog OS=Xenopus tropicalis GN=ovca2 PE=2 SV=2 1 216 6.0E-09
sp|Q3SZ07|OVCA2_BOVIN Ovarian cancer-associated gene 2 protein homolog OS=Bos taurus GN=OVCA2 PE=2 SV=1 1 216 2.0E-07
sp|Q0C8M2|LOVG_ASPTN Esterase LovG OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovG PE=1 SV=1 3 216 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 114 136 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5086
MRILCLHGTGLNSSIFAAQTARLRDLLPTNYTYEWIDGPHQVEPPRLIADAHSGPYLSYMESLTTEGVADAIDAL
EALIQEKGPFDGAMGMSQGAMLIAALLIRRQMNARPNPVRFAIFIAGILPLSWTVSIGQAVDDVRGWRPPLVTKD
PSCEWLRECGQVRCFNPGVYGERLNLPTVHVWGRGDGLRKQAEMMVRLCNPDLVGSYQHTGGHQVPQPWSDNEAV
SEMIREAVMRKLIDGMAVMTYKTAAAETQAILEKKPRNTIQDAGMAS*
Coding >Ophun1|5086
ATGCGCATCCTCTGTCTTCACGGAACGGGCCTCAACAGCTCCATCTTCGCCGCCCAAACTGCCAGGCTACGAGAC
CTCCTCCCCACAAACTACACATACGAATGGATCGACGGTCCGCACCAAGTCGAGCCACCCCGACTCATCGCAGAC
GCCCACTCCGGCCCCTACCTTTCATACATGGAGTCGTTGACGACTGAGGGCGTAGCGGATGCTATTGACGCCCTC
GAAGCACTGATACAAGAAAAGGGGCCCTTTGACGGAGCTATGGGCATGTCGCAGGGCGCCATGCTCATCGCCGCC
CTGCTCATCAGGCGGCAGATGAACGCAAGGCCAAACCCAGTCCGGTTCGCCATCTTCATCGCCGGTATACTCCCC
CTATCGTGGACGGTATCCATCGGACAAGCCGTCGATGACGTCCGGGGCTGGCGTCCGCCACTCGTCACCAAGGAC
CCGAGCTGCGAGTGGCTCCGGGAATGCGGTCAGGTCCGCTGCTTCAATCCAGGAGTGTACGGCGAGAGGCTGAAT
CTGCCGACGGTGCATGTCTGGGGTCGTGGCGATGGGTTGAGAAAGCAGGCTGAGATGATGGTCAGGCTGTGCAAT
CCTGATCTGGTGGGGAGTTATCAGCATACGGGTGGGCATCAGGTTCCGCAGCCGTGGTCGGATAATGAGGCTGTG
AGTGAGATGATTCGGGAGGCTGTCATGCGGAAGCTCATCGACGGCATGGCTGTGATGACGTACAAGACTGCAGCA
GCCGAGACGCAGGCTATTCTGGAGAAGAAGCCGAGAAACACCATTCAAGATGCTGGCATGGCTTCCTGA
Transcript >Ophun1|5086
ATGCGCATCCTCTGTCTTCACGGAACGGGCCTCAACAGCTCCATCTTCGCCGCCCAAACTGCCAGGCTACGAGAC
CTCCTCCCCACAAACTACACATACGAATGGATCGACGGTCCGCACCAAGTCGAGCCACCCCGACTCATCGCAGAC
GCCCACTCCGGCCCCTACCTTTCATACATGGAGTCGTTGACGACTGAGGGCGTAGCGGATGCTATTGACGCCCTC
GAAGCACTGATACAAGAAAAGGGGCCCTTTGACGGAGCTATGGGCATGTCGCAGGGCGCCATGCTCATCGCCGCC
CTGCTCATCAGGCGGCAGATGAACGCAAGGCCAAACCCAGTCCGGTTCGCCATCTTCATCGCCGGTATACTCCCC
CTATCGTGGACGGTATCCATCGGACAAGCCGTCGATGACGTCCGGGGCTGGCGTCCGCCACTCGTCACCAAGGAC
CCGAGCTGCGAGTGGCTCCGGGAATGCGGTCAGGTCCGCTGCTTCAATCCAGGAGTGTACGGCGAGAGGCTGAAT
CTGCCGACGGTGCATGTCTGGGGTCGTGGCGATGGGTTGAGAAAGCAGGCTGAGATGATGGTCAGGCTGTGCAAT
CCTGATCTGGTGGGGAGTTATCAGCATACGGGTGGGCATCAGGTTCCGCAGCCGTGGTCGGATAATGAGGCTGTG
AGTGAGATGATTCGGGAGGCTGTCATGCGGAAGCTCATCGACGGCATGGCTGTGATGACGTACAAGACTGCAGCA
GCCGAGACGCAGGCTATTCTGGAGAAGAAGCCGAGAAACACCATTCAAGATGCTGGCATGGCTTCCTGA
Gene >Ophun1|5086
ATGCGCATCCTCTGTCTTCACGGAACGGGCCTCAACAGCTCCATCTTCGCCGCCCAAACTGCCAGGCTACGAGAC
CTCCTCCCCACAAACTACACATACGAATGGATCGACGGTCCGCACCAAGTCGAGCCACCCCGACTCATCGCAGAC
GCCCACTCCGGCCCCTACCTTTCATACATGGAGTCGTTGACGACTGAGGGCGTAGCGGATGCTATTGACGCCCTC
GAAGCACTGATACAAGAAAAGGGGCCCTTTGACGGAGCTATGGGCATGTCGCAGGTAAGTCGACCCTGTTCCTCA
CCTATAGCAGAGCTAAAGTCTCAAAGGGCGCCATGCTCATCGCCGCCCTGCTCATCAGGCGGCAGATGAACGCAA
GGCCAAACCCAGTCCGGTTCGCCATCTTCATCGCCGGTATACTCCCCCTATCGTGGACGGTATCCATCGGACAAG
CCGTCGATGACGTCCGGGGCTGGCGTCCGCCACTCGTCACCAAGGACCCGAGCTGCGAGTGGCTCCGGGAATGCG
GTCAGGTCCGCTGCTTCAATCCAGGAGTGTACGGCGAGAGGCTGAATCTGCCGACGGTGCATGTCTGGGGTCGTG
GCGATGGGTTGAGAAAGCAGGCTGAGATGATGGTCAGGCTGTGCAATCCTGATCTGGTGGGGAGTTATCAGCATA
CGGGTGGGCATCAGGTTCCGCAGCCGTGGTCGGATAATGAGGCTGTGAGTGAGATGATTCGGGAGGCTGTCATGC
GGAGTGAGTACATGTATGCTGCGTAGCATCAGGTTCATGAGGGTTACGGGCTTGAGTGTCTGTGTAGGTGAGAGG
TGGCTGCTCGATGGGTTGCGATGCGGGTTGCTTAGCCGCAACGCAGCCCCTGATGGGATTCAAAATGAATGCCAC
CAAAAGGGCCGACAAGAACAAATGGTATCCGTTATTACATGGCAAACATCACCTGAAGAGGGTAATGGGTTAGAC
AAGGATCCGCGCCTCGATATTGCATGTGTATCTGACGTCGTTGCCACTGGTTCCCTCAGAGCTCATCGACGGCAT
GGCTGTGATGACGTACAAGACTGCAGCAGCCGAGACGCAGGCTATTCTGGAGAAGAAGCCGAGAAACACCGTGAG
TGTCGATGGTGACATGCTCTCGCGTCCAAGCTCGATGGCTGCCTAGATTCAAGATGCTGGCATGGCTTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail