Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5082
Gene name
LocationContig_489:4872..6769
Strand-
Gene length (bp)1897
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00162 PGK Phosphoglycerate kinase 9.1E-151 122 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24590|PGK_HYPRU Phosphoglycerate kinase OS=Hypocrea rufa GN=pgk1 PE=3 SV=2 114 530 0.0E+00
sp|P14228|PGK_HYPJE Phosphoglycerate kinase OS=Hypocrea jecorina GN=pgk1 PE=3 SV=1 114 530 0.0E+00
sp|P38667|PGK_NEUCR Phosphoglycerate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pgk-1 PE=2 SV=2 114 530 0.0E+00
sp|P41756|PGK_ASPOR Phosphoglycerate kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgkA PE=3 SV=1 114 530 0.0E+00
sp|P33161|PGK_PENCI Phosphoglycerate kinase OS=Penicillium citrinum GN=PGKA PE=3 SV=1 114 530 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24590|PGK_HYPRU Phosphoglycerate kinase OS=Hypocrea rufa GN=pgk1 PE=3 SV=2 114 530 0.0E+00
sp|P14228|PGK_HYPJE Phosphoglycerate kinase OS=Hypocrea jecorina GN=pgk1 PE=3 SV=1 114 530 0.0E+00
sp|P38667|PGK_NEUCR Phosphoglycerate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pgk-1 PE=2 SV=2 114 530 0.0E+00
sp|P41756|PGK_ASPOR Phosphoglycerate kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgkA PE=3 SV=1 114 530 0.0E+00
sp|P33161|PGK_PENCI Phosphoglycerate kinase OS=Penicillium citrinum GN=PGKA PE=3 SV=1 114 530 0.0E+00
sp|P11977|PGK_EMENI Phosphoglycerate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgkA PE=3 SV=2 114 530 0.0E+00
sp|O60101|PGK_SCHPO Phosphoglycerate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgk1 PE=1 SV=1 114 530 0.0E+00
sp|O74233|PGK_FUNMO Phosphoglycerate kinase OS=Funneliformis mosseae GN=PGK PE=2 SV=1 114 530 0.0E+00
sp|P29405|PGK1_RHINI Phosphoglycerate kinase 1 OS=Rhizopus niveus GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|P29407|PGK_YARLI Phosphoglycerate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|P46273|PGK_CANAL Phosphoglycerate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|P29406|PGK2_RHINI Phosphoglycerate kinase 2 OS=Rhizopus niveus GN=PGK2 PE=3 SV=1 114 530 0.0E+00
sp|Q7ZA46|PGK_PICPA Phosphoglycerate kinase OS=Komagataella pastoris GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|P00560|PGK_YEAST Phosphoglycerate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGK1 PE=1 SV=2 114 530 0.0E+00
sp|P41757|PGK_CANMA Phosphoglycerate kinase OS=Candida maltosa GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|P09188|PGK_PENCH Phosphoglycerate kinase OS=Penicillium chrysogenum GN=PGKA PE=3 SV=1 114 530 0.0E+00
sp|P51903|PGK_CHICK Phosphoglycerate kinase OS=Gallus gallus GN=PGK PE=2 SV=2 114 529 0.0E+00
sp|Q6FKY1|PGK_CANGA Phosphoglycerate kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|Q6BLA0|PGK_DEBHA Phosphoglycerate kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PGK1 PE=3 SV=1 114 530 0.0E+00
sp|P14828|PGK_KLULA Phosphoglycerate kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PGK PE=3 SV=2 114 530 0.0E+00
sp|Q3T0P6|PGK1_BOVIN Phosphoglycerate kinase 1 OS=Bos taurus GN=PGK1 PE=2 SV=3 114 529 0.0E+00
sp|O94123|PGK_AGABI Phosphoglycerate kinase OS=Agaricus bisporus GN=pgkA PE=2 SV=1 114 530 0.0E+00
sp|Q5NVB5|PGK1_PONAB Phosphoglycerate kinase 1 OS=Pongo abelii GN=PGK1 PE=2 SV=4 114 529 0.0E+00
sp|Q60HD8|PGK1_MACFA Phosphoglycerate kinase 1 OS=Macaca fascicularis GN=PGK1 PE=2 SV=3 114 529 0.0E+00
sp|P09411|PGK1_MOUSE Phosphoglycerate kinase 1 OS=Mus musculus GN=Pgk1 PE=1 SV=4 114 529 0.0E+00
sp|P50310|PGK1_CRIGR Phosphoglycerate kinase 1 OS=Cricetulus griseus GN=PGK1 PE=2 SV=2 114 529 0.0E+00
sp|P91427|PGK_CAEEL Probable phosphoglycerate kinase OS=Caenorhabditis elegans GN=pgk-1 PE=3 SV=1 114 528 0.0E+00
sp|A5A6K4|PGK1_PANTR Phosphoglycerate kinase 1 OS=Pan troglodytes GN=PGK1 PE=2 SV=1 114 529 0.0E+00
sp|P00558|PGK1_HUMAN Phosphoglycerate kinase 1 OS=Homo sapiens GN=PGK1 PE=1 SV=3 114 529 0.0E+00
sp|Q757Q0|PGK_ASHGO Phosphoglycerate kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PGK1 PE=3 SV=3 114 530 0.0E+00
sp|P00559|PGK1_HORSE Phosphoglycerate kinase 1 OS=Equus caballus GN=PGK1 PE=1 SV=2 114 529 0.0E+00
sp|P16617|PGK1_RAT Phosphoglycerate kinase 1 OS=Rattus norvegicus GN=Pgk1 PE=1 SV=2 114 529 0.0E+00
sp|P09041|PGK2_MOUSE Phosphoglycerate kinase 2 OS=Mus musculus GN=Pgk2 PE=1 SV=4 114 529 0.0E+00
sp|Q7SIB7|PGK1_PIG Phosphoglycerate kinase 1 OS=Sus scrofa GN=PGK1 PE=1 SV=3 114 529 0.0E+00
sp|Q6RI85|PGK2_PIG Phosphoglycerate kinase 2 OS=Sus scrofa GN=PGK2 PE=2 SV=3 114 529 0.0E+00
sp|Q8MIF7|PGK2_HORSE Phosphoglycerate kinase 2 OS=Equus caballus GN=PGK2 PE=3 SV=3 114 529 0.0E+00
sp|Q4R3K4|PGK2_MACFA Phosphoglycerate kinase 2 OS=Macaca fascicularis GN=PGK2 PE=2 SV=1 114 529 0.0E+00
sp|P29408|PGK1_MACEU Phosphoglycerate kinase 1 OS=Macropus eugenii GN=PGK1 PE=2 SV=2 114 529 0.0E+00
sp|P07205|PGK2_HUMAN Phosphoglycerate kinase 2 OS=Homo sapiens GN=PGK2 PE=1 SV=3 114 529 0.0E+00
sp|Q9GPM4|PGK_DICDI Phosphoglycerate kinase OS=Dictyostelium discoideum GN=pgkA PE=1 SV=2 116 528 0.0E+00
sp|P41759|PGK_SCHMA Phosphoglycerate kinase OS=Schistosoma mansoni GN=PGK PE=1 SV=1 119 528 0.0E+00
sp|Q01604|PGK_DROME Phosphoglycerate kinase OS=Drosophila melanogaster GN=Pgk PE=2 SV=2 118 529 4.0E-173
sp|P50311|PGK_OPISI Phosphoglycerate kinase OS=Opisthorchis sinensis GN=PGK PE=2 SV=2 118 528 6.0E-173
sp|O61471|PGK_APLCA Phosphoglycerate kinase OS=Aplysia californica GN=PGK PE=2 SV=1 118 528 5.0E-172
sp|P27362|PGK_PLAF7 Phosphoglycerate kinase OS=Plasmodium falciparum (isolate 3D7) GN=PGK PE=1 SV=1 116 530 4.0E-169
sp|P50313|PGK_TETTH Phosphoglycerate kinase OS=Tetrahymena thermophila GN=PGK PE=2 SV=1 116 528 4.0E-155
sp|O02608|PGK_EUPCR Phosphoglycerate kinase OS=Euplotes crassus GN=PGK PE=3 SV=1 116 528 3.0E-149
sp|O02609|PGK_STENO Phosphoglycerate kinase OS=Sterkiella nova GN=PGK PE=3 SV=1 116 530 3.0E-149
sp|O00871|PGK_TETPY Phosphoglycerate kinase (Fragment) OS=Tetrahymena pyriformis GN=PGK PE=3 SV=1 136 510 4.0E-143
sp|O00940|PGK_CONMG Phosphoglycerate kinase (Fragment) OS=Condylostoma magnum GN=PGK PE=3 SV=1 136 512 4.0E-143
sp|O00852|PGK_GLACH Phosphoglycerate kinase (Fragment) OS=Glaucoma chattoni GN=PGK PE=3 SV=1 136 512 7.0E-141
sp|P12783|PGKY_WHEAT Phosphoglycerate kinase, cytosolic OS=Triticum aestivum PE=2 SV=1 121 527 2.0E-134
sp|Q42962|PGKY_TOBAC Phosphoglycerate kinase, cytosolic OS=Nicotiana tabacum PE=2 SV=1 121 527 5.0E-134
sp|P29409|PGKH_SPIOL Phosphoglycerate kinase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=2 101 528 4.0E-132
sp|P12782|PGKH_WHEAT Phosphoglycerate kinase, chloroplastic OS=Triticum aestivum PE=2 SV=1 126 532 6.0E-132
sp|Q42961|PGKH_TOBAC Phosphoglycerate kinase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 95 527 1.0E-130
sp|P50318|PGKH2_ARATH Phosphoglycerate kinase 2, chloroplastic OS=Arabidopsis thaliana GN=At1g56190 PE=2 SV=3 67 527 1.0E-129
sp|Q31P73|PGK_SYNE7 Phosphoglycerate kinase OS=Synechococcus elongatus (strain PCC 7942) GN=pgk PE=3 SV=1 114 527 1.0E-128
sp|B3QWD9|PGK_CHLT3 Phosphoglycerate kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=pgk PE=3 SV=1 118 529 2.0E-128
sp|Q9LD57|PGKH1_ARATH Phosphoglycerate kinase 1, chloroplastic OS=Arabidopsis thaliana GN=PGK1 PE=1 SV=1 114 527 3.0E-128
sp|Q2JXF0|PGK_SYNJA Phosphoglycerate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pgk PE=3 SV=1 126 528 5.0E-128
sp|Q8KAE1|PGK_CHLTE Phosphoglycerate kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pgk PE=3 SV=1 118 528 1.0E-127
sp|O00869|PGK_PARPR Phosphoglycerate kinase (Fragment) OS=Paramecium primaurelia GN=PGK PE=3 SV=1 136 504 4.0E-127
sp|Q5N4Z6|PGK_SYNP6 Phosphoglycerate kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pgk PE=3 SV=1 114 527 9.0E-127
sp|B3QLX7|PGK_CHLP8 Phosphoglycerate kinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=pgk PE=3 SV=1 118 528 2.0E-126
sp|A5IJ98|PGK_THEP1 Phosphoglycerate kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pgk PE=3 SV=1 118 530 4.0E-126
sp|B1L8B8|PGK_THESQ Phosphoglycerate kinase OS=Thermotoga sp. (strain RQ2) GN=pgk PE=3 SV=1 118 530 1.0E-125
sp|A6LMG3|PGK_THEM4 Phosphoglycerate kinase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=pgk PE=3 SV=1 118 530 7.0E-125
sp|Q9SBN4|PGKH_VOLCA Phosphoglycerate kinase, chloroplastic OS=Volvox carteri GN=PGK PE=2 SV=1 81 530 8.0E-125
sp|B7IDG7|PGK_THEAB Phosphoglycerate kinase OS=Thermosipho africanus (strain TCF52B) GN=pgk PE=3 SV=1 118 530 9.0E-125
sp|Q0I6M5|PGK_SYNS3 Phosphoglycerate kinase OS=Synechococcus sp. (strain CC9311) GN=pgk PE=3 SV=1 126 527 9.0E-125
sp|Q3AGU1|PGK_SYNSC Phosphoglycerate kinase OS=Synechococcus sp. (strain CC9605) GN=pgk PE=3 SV=1 121 527 1.0E-124
sp|B7JVE4|PGK_CYAP8 Phosphoglycerate kinase OS=Cyanothece sp. (strain PCC 8801) GN=pgk PE=3 SV=1 126 527 3.0E-124
sp|B7K9Q5|PGK_CYAP7 Phosphoglycerate kinase OS=Cyanothece sp. (strain PCC 7424) GN=pgk PE=3 SV=1 126 527 1.0E-123
sp|Q1INK7|PGK_KORVE Phosphoglycerate kinase OS=Koribacter versatilis (strain Ellin345) GN=pgk PE=3 SV=1 119 530 2.0E-123
sp|C1F1M9|PGK_ACIC5 Phosphoglycerate kinase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=pgk PE=3 SV=1 119 530 2.0E-123
sp|Q3ANU2|PGK_CHLCH Phosphoglycerate kinase OS=Chlorobium chlorochromatii (strain CaD3) GN=pgk PE=3 SV=1 121 528 3.0E-123
sp|B4S6S2|PGK_PROA2 Phosphoglycerate kinase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=pgk PE=3 SV=1 118 528 4.0E-123
sp|P41758|PGKH_CHLRE Phosphoglycerate kinase, chloroplastic OS=Chlamydomonas reinhardtii PE=1 SV=1 100 530 4.0E-123
sp|P36204|PGKT_THEMA Bifunctional PGK/TIM OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pgk/tpi PE=1 SV=4 118 530 5.0E-123
sp|Q8R965|PGK_CALS4 Phosphoglycerate kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pgk PE=3 SV=1 118 530 1.0E-122
sp|A7HL11|PGK_FERNB Phosphoglycerate kinase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pgk PE=3 SV=1 118 530 2.0E-122
sp|A5GPB2|PGK_SYNPW Phosphoglycerate kinase OS=Synechococcus sp. (strain WH7803) GN=pgk PE=3 SV=1 121 528 2.0E-122
sp|Q3AVX6|PGK_SYNS9 Phosphoglycerate kinase OS=Synechococcus sp. (strain CC9902) GN=pgk PE=3 SV=1 121 527 3.0E-122
sp|A5GW73|PGK_SYNR3 Phosphoglycerate kinase OS=Synechococcus sp. (strain RCC307) GN=pgk PE=3 SV=1 118 527 4.0E-122
sp|P74421|PGK_SYNY3 Phosphoglycerate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pgk PE=3 SV=2 121 530 6.0E-122
sp|Q7U3V0|PGK_SYNPX Phosphoglycerate kinase OS=Synechococcus sp. (strain WH8102) GN=pgk PE=3 SV=1 121 528 1.0E-121
sp|A8F5X9|PGK_PSELT Phosphoglycerate kinase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=pgk PE=3 SV=1 118 530 6.0E-121
sp|B4SHF6|PGK_PELPB Phosphoglycerate kinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pgk PE=3 SV=1 118 528 7.0E-121
sp|Q7VDZ4|PGK_PROMA Phosphoglycerate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pgk PE=3 SV=1 120 527 1.0E-120
sp|Q8DGP7|PGK_THEEB Phosphoglycerate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=pgk PE=3 SV=1 126 527 2.0E-120
sp|A4SH15|PGK_CHLPM Phosphoglycerate kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pgk PE=3 SV=1 118 528 2.0E-120
sp|A1BJZ1|PGK_CHLPD Phosphoglycerate kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=pgk PE=3 SV=1 118 528 4.0E-120
sp|Q2JKX6|PGK_SYNJB Phosphoglycerate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pgk PE=3 SV=1 126 528 6.0E-120
sp|Q3AFD1|PGK_CARHZ Phosphoglycerate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pgk PE=3 SV=1 121 530 7.0E-120
sp|A0PYP1|PGK_CLONN Phosphoglycerate kinase OS=Clostridium novyi (strain NT) GN=pgk PE=3 SV=1 114 530 1.0E-119
sp|B1XNQ1|PGK_SYNP2 Phosphoglycerate kinase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=pgk PE=3 SV=1 121 527 1.0E-119
sp|Q31CY6|PGK_PROM9 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=pgk PE=3 SV=1 114 528 1.0E-119
sp|B8HXQ5|PGK_CYAP4 Phosphoglycerate kinase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pgk PE=3 SV=1 126 527 1.0E-119
sp|A2BUH2|PGK_PROM5 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=pgk PE=3 SV=1 114 528 2.0E-119
sp|B3EQD1|PGK_CHLPB Phosphoglycerate kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=pgk PE=3 SV=1 118 528 2.0E-119
sp|Q7V461|PGK_PROMM Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=pgk PE=3 SV=1 126 527 6.0E-119
sp|Q67SW6|PGK_SYMTH Phosphoglycerate kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pgk PE=3 SV=1 120 530 9.0E-119
sp|A2BNZ0|PGK_PROMS Phosphoglycerate kinase OS=Prochlorococcus marinus (strain AS9601) GN=pgk PE=3 SV=1 114 528 1.0E-118
sp|A2CDG7|PGK_PROM3 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9303) GN=pgk PE=3 SV=1 121 527 1.0E-118
sp|Q7V390|PGK_PROMP Phosphoglycerate kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=pgk PE=3 SV=1 114 527 1.0E-118
sp|A5N2N8|PGK_CLOK5 Phosphoglycerate kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pgk PE=3 SV=1 118 530 2.0E-118
sp|B9E6B4|PGK_CLOK1 Phosphoglycerate kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=pgk PE=3 SV=1 118 530 2.0E-118
sp|A8G2K1|PGK_PROM2 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=pgk PE=3 SV=1 114 528 2.0E-118
sp|B2S1P1|PGK_BORHD Phosphoglycerate kinase OS=Borrelia hermsii (strain HS1 / DAH) GN=pgk PE=3 SV=1 121 527 2.0E-118
sp|B8G4H3|PGK_CHLAD Phosphoglycerate kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pgk PE=3 SV=1 121 528 3.0E-118
sp|Q898R3|PGK_CLOTE Phosphoglycerate kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=pgk PE=3 SV=1 112 530 5.0E-118
sp|Q5KVE4|PGK_GEOKA Phosphoglycerate kinase OS=Geobacillus kaustophilus (strain HTA426) GN=pgk PE=3 SV=1 121 530 6.0E-118
sp|B1YLE1|PGK_EXIS2 Phosphoglycerate kinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=pgk PE=3 SV=1 119 530 6.0E-118
sp|B0JT86|PGK_MICAN Phosphoglycerate kinase OS=Microcystis aeruginosa (strain NIES-843) GN=pgk PE=3 SV=1 121 527 7.0E-118
sp|A5HYC0|PGK_CLOBH Phosphoglycerate kinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pgk PE=3 SV=1 118 530 8.0E-118
sp|A7FQN7|PGK_CLOB1 Phosphoglycerate kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pgk PE=3 SV=1 118 530 8.0E-118
sp|B0CD95|PGK_ACAM1 Phosphoglycerate kinase OS=Acaryochloris marina (strain MBIC 11017) GN=pgk PE=3 SV=1 126 527 9.0E-118
sp|Q2RLU1|PGK_MOOTA Phosphoglycerate kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=pgk PE=3 SV=1 119 530 2.0E-117
sp|A1QYK6|PGK_BORT9 Phosphoglycerate kinase OS=Borrelia turicatae (strain 91E135) GN=pgk PE=3 SV=1 121 527 2.0E-117
sp|A7G9Y0|PGK_CLOBL Phosphoglycerate kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pgk PE=3 SV=1 118 530 3.0E-117
sp|C3KYR4|PGK_CLOB6 Phosphoglycerate kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pgk PE=3 SV=1 118 530 3.0E-117
sp|A2C025|PGK_PROM1 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain NATL1A) GN=pgk PE=3 SV=1 126 527 4.0E-117
sp|B1IDB6|PGK_CLOBK Phosphoglycerate kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=pgk PE=3 SV=1 118 530 4.0E-117
sp|Q46HH8|PGK_PROMT Phosphoglycerate kinase OS=Prochlorococcus marinus (strain NATL2A) GN=pgk PE=3 SV=1 126 527 5.0E-117
sp|B1KTJ5|PGK_CLOBM Phosphoglycerate kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pgk PE=3 SV=1 118 530 9.0E-117
sp|A3PAR3|PGK_PROM0 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9301) GN=pgk PE=3 SV=1 114 528 1.0E-116
sp|C4L5H7|PGK_EXISA Phosphoglycerate kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=pgk PE=3 SV=1 118 530 1.0E-116
sp|C1FQW3|PGK_CLOBJ Phosphoglycerate kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pgk PE=3 SV=1 118 530 1.0E-116
sp|Q3MF40|PGK_ANAVT Phosphoglycerate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pgk PE=3 SV=1 114 527 2.0E-116
sp|P18912|PGK_GEOSE Phosphoglycerate kinase OS=Geobacillus stearothermophilus GN=pgk PE=1 SV=2 121 530 2.0E-116
sp|O52632|PGK_CLOAB Phosphoglycerate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pgk PE=3 SV=1 118 530 2.0E-116
sp|C6E770|PGK_GEOSM Phosphoglycerate kinase OS=Geobacter sp. (strain M21) GN=pgk PE=3 SV=1 122 530 4.0E-116
sp|B5EF40|PGK_GEOBB Phosphoglycerate kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=pgk PE=3 SV=1 122 530 6.0E-116
sp|A5G382|PGK_GEOUR Phosphoglycerate kinase OS=Geobacter uraniireducens (strain Rf4) GN=pgk PE=3 SV=1 122 528 1.0E-115
sp|A9BDF8|PGK_PROM4 Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9211) GN=pgk PE=3 SV=1 129 527 1.0E-115
sp|Q8YPR1|PGK_NOSS1 Phosphoglycerate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pgk PE=1 SV=1 114 527 7.0E-115
sp|B2ITU1|PGK_NOSP7 Phosphoglycerate kinase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pgk PE=3 SV=1 126 527 8.0E-115
sp|P62409|PGK_BACC1 Phosphoglycerate kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pgk PE=3 SV=1 121 530 8.0E-115
sp|C5D7M4|PGK_GEOSW Phosphoglycerate kinase OS=Geobacillus sp. (strain WCH70) GN=pgk PE=3 SV=1 121 530 1.0E-114
sp|Q39U98|PGK_GEOMG Phosphoglycerate kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pgk PE=3 SV=1 122 528 1.0E-114
sp|B3EIM1|PGK_CHLL2 Phosphoglycerate kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pgk PE=3 SV=1 118 528 1.0E-114
sp|A7GUS0|PGK_BACCN Phosphoglycerate kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pgk PE=3 SV=1 121 530 1.0E-114
sp|B7GL27|PGK_ANOFW Phosphoglycerate kinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pgk PE=3 SV=1 121 530 2.0E-114
sp|C0Z6L6|PGK_BREBN Phosphoglycerate kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pgk PE=3 SV=1 121 528 2.0E-114
sp|B5RKV5|PGK_BORDL Phosphoglycerate kinase OS=Borrelia duttonii (strain Ly) GN=pgk PE=3 SV=1 121 527 3.0E-114
sp|B5RQN5|PGK_BORRA Phosphoglycerate kinase OS=Borrelia recurrentis (strain A1) GN=pgk PE=3 SV=1 121 527 3.0E-114
sp|P24269|PGK_BACMD Phosphoglycerate kinase OS=Bacillus megaterium (strain DSM 319) GN=pgk PE=3 SV=1 118 530 4.0E-114
sp|Q2II25|PGK_ANADE Phosphoglycerate kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pgk PE=3 SV=1 121 526 5.0E-114
sp|B9LM50|PGK_CHLSY Phosphoglycerate kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pgk PE=3 SV=1 121 528 5.0E-114
sp|A9WKE4|PGK_CHLAA Phosphoglycerate kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pgk PE=3 SV=1 121 528 5.0E-114
sp|Q631L9|PGK_BACCZ Phosphoglycerate kinase OS=Bacillus cereus (strain ZK / E33L) GN=pgk PE=3 SV=1 121 530 6.0E-114
sp|B9L8C3|PGK_NAUPA Phosphoglycerate kinase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=pgk PE=3 SV=1 121 530 6.0E-114
sp|B4UEJ2|PGK_ANASK Phosphoglycerate kinase OS=Anaeromyxobacter sp. (strain K) GN=pgk PE=3 SV=1 121 526 1.0E-113
sp|Q181T8|PGK_PEPD6 Phosphoglycerate kinase OS=Peptoclostridium difficile (strain 630) GN=pgk PE=3 SV=1 114 530 1.0E-113
sp|P62421|PGK_TREDE Phosphoglycerate kinase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=pgk PE=3 SV=1 121 529 1.0E-113
sp|Q3B116|PGK_CHLL7 Phosphoglycerate kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pgk PE=3 SV=1 118 528 1.0E-113
sp|Q65EM9|PGK_BACLD Phosphoglycerate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pgk PE=3 SV=1 119 530 2.0E-113
sp|B7HW55|PGK_BACC7 Phosphoglycerate kinase OS=Bacillus cereus (strain AH187) GN=pgk PE=3 SV=1 121 530 2.0E-113
sp|Q03UX8|PGK_LEUMM Phosphoglycerate kinase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=pgk PE=3 SV=1 119 530 5.0E-113
sp|B9J4M7|PGK_BACCQ Phosphoglycerate kinase OS=Bacillus cereus (strain Q1) GN=pgk PE=3 SV=1 121 530 6.0E-113
sp|Q81X75|PGK_BACAN Phosphoglycerate kinase OS=Bacillus anthracis GN=pgk PE=1 SV=1 121 530 7.0E-113
sp|C3LDI3|PGK_BACAC Phosphoglycerate kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pgk PE=3 SV=1 121 530 7.0E-113
sp|C3P0A6|PGK_BACAA Phosphoglycerate kinase OS=Bacillus anthracis (strain A0248) GN=pgk PE=3 SV=1 121 530 7.0E-113
sp|B9M2C3|PGK_GEODF Phosphoglycerate kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pgk PE=3 SV=1 120 528 8.0E-113
sp|B8JBD5|PGK_ANAD2 Phosphoglycerate kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pgk PE=3 SV=1 121 526 9.0E-113
sp|Q8XKU0|PGK_CLOPE Phosphoglycerate kinase OS=Clostridium perfringens (strain 13 / Type A) GN=pgk PE=3 SV=1 118 530 2.0E-112
sp|Q0TQY7|PGK_CLOP1 Phosphoglycerate kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pgk PE=3 SV=1 118 530 2.0E-112
sp|B7HED5|PGK_BACC4 Phosphoglycerate kinase OS=Bacillus cereus (strain B4264) GN=pgk PE=3 SV=1 121 530 2.0E-112
sp|Q8F5H8|PGK_LEPIN Phosphoglycerate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pgk PE=3 SV=1 114 530 2.0E-112
sp|C1EZA3|PGK_BACC3 Phosphoglycerate kinase OS=Bacillus cereus (strain 03BB102) GN=pgk PE=3 SV=1 121 530 3.0E-112
sp|B7JFG6|PGK_BACC0 Phosphoglycerate kinase OS=Bacillus cereus (strain AH820) GN=pgk PE=3 SV=1 121 530 3.0E-112
sp|A0RKS6|PGK_BACAH Phosphoglycerate kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=pgk PE=3 SV=1 121 530 3.0E-112
sp|B2TPX4|PGK_CLOBB Phosphoglycerate kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pgk PE=3 SV=1 118 528 4.0E-112
sp|A7HCN7|PGK_ANADF Phosphoglycerate kinase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pgk PE=3 SV=1 121 528 4.0E-112
sp|Q01Y83|PGK_SOLUE Phosphoglycerate kinase OS=Solibacter usitatus (strain Ellin6076) GN=pgk PE=3 SV=1 120 527 5.0E-112
sp|Q0STD5|PGK_CLOPS Phosphoglycerate kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=pgk PE=3 SV=1 118 530 5.0E-112
sp|Q6HBF0|PGK_BACHK Phosphoglycerate kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pgk PE=3 SV=1 121 530 7.0E-112
sp|O66519|PGK_AQUAE Phosphoglycerate kinase OS=Aquifex aeolicus (strain VF5) GN=pgk PE=3 SV=1 116 522 1.0E-111
sp|B8E2D3|PGK_DICTD Phosphoglycerate kinase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pgk PE=3 SV=1 120 530 2.0E-111
sp|Q9K714|PGK_BACHD Phosphoglycerate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pgk PE=3 SV=1 119 530 2.0E-111
sp|B7IP23|PGK_BACC2 Phosphoglycerate kinase OS=Bacillus cereus (strain G9842) GN=pgk PE=3 SV=1 121 530 3.0E-111
sp|B2UY23|PGK_CLOBA Phosphoglycerate kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pgk PE=3 SV=1 118 528 3.0E-111
sp|Q662V8|PGK_BORBP Phosphoglycerate kinase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=pgk PE=3 SV=1 129 527 4.0E-111
sp|A9VQ51|PGK_BACWK Phosphoglycerate kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pgk PE=3 SV=1 121 530 5.0E-111
sp|P40924|PGK_BACSU Phosphoglycerate kinase OS=Bacillus subtilis (strain 168) GN=pgk PE=1 SV=3 119 530 5.0E-111
sp|P62414|PGK_LEPIC Phosphoglycerate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pgk PE=3 SV=1 114 530 7.0E-111
sp|Q6AS45|PGK_DESPS Phosphoglycerate kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pgk PE=3 SV=1 121 528 2.0E-110
sp|A1APN7|PGK_PELPD Phosphoglycerate kinase OS=Pelobacter propionicus (strain DSM 2379) GN=pgk PE=3 SV=1 126 530 2.0E-110
sp|Q04TE9|PGK_LEPBJ Phosphoglycerate kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pgk PE=3 SV=1 114 530 3.0E-110
sp|Q5WDK6|PGK_BACSK Phosphoglycerate kinase OS=Bacillus clausii (strain KSM-K16) GN=pgk PE=3 SV=1 124 530 4.0E-110
sp|Q8ENP3|PGK_OCEIH Phosphoglycerate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pgk PE=3 SV=1 118 530 8.0E-110
sp|A8EWM4|PGK_ARCB4 Phosphoglycerate kinase OS=Arcobacter butzleri (strain RM4018) GN=pgk PE=3 SV=1 121 527 1.0E-109
sp|Q052H7|PGK_LEPBL Phosphoglycerate kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pgk PE=3 SV=1 114 530 1.0E-109
sp|B1MW69|PGK_LEUCK Phosphoglycerate kinase OS=Leuconostoc citreum (strain KM20) GN=pgk PE=3 SV=1 119 530 1.0E-109
sp|B5YE95|PGK_DICT6 Phosphoglycerate kinase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pgk PE=3 SV=1 120 530 1.0E-109
sp|Q03SL7|PGK_LACBA Phosphoglycerate kinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pgk PE=3 SV=1 119 530 2.0E-109
sp|Q10Z46|PGK_TRIEI Phosphoglycerate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=pgk PE=3 SV=1 121 527 2.0E-109
sp|A6Q539|PGK_NITSB Phosphoglycerate kinase OS=Nitratiruptor sp. (strain SB155-2) GN=pgk PE=3 SV=1 121 528 4.0E-109
sp|A8FHJ3|PGK_BACP2 Phosphoglycerate kinase OS=Bacillus pumilus (strain SAFR-032) GN=pgk PE=3 SV=1 119 530 6.0E-109
sp|Q0SPA9|PGK_BORAP Phosphoglycerate kinase OS=Borrelia afzelii (strain PKo) GN=pgk PE=3 SV=1 129 527 7.0E-109
sp|A5UTB6|PGK_ROSS1 Phosphoglycerate kinase OS=Roseiflexus sp. (strain RS-1) GN=pgk PE=3 SV=1 121 528 7.0E-109
sp|B3WCW5|PGK_LACCB Phosphoglycerate kinase OS=Lactobacillus casei (strain BL23) GN=pgk PE=3 SV=1 119 530 9.0E-109
sp|Q03AK6|PGK_LACC3 Phosphoglycerate kinase OS=Lactobacillus casei (strain ATCC 334) GN=pgk PE=3 SV=1 119 530 9.0E-109
sp|P07377|PGKB_TRYBB Phosphoglycerate kinase, cytosolic OS=Trypanosoma brucei brucei PE=3 SV=1 114 527 1.0E-108
sp|Q27683|PGKB_LEIMA Phosphoglycerate kinase, cytosolic OS=Leishmania major GN=PGKB PE=3 SV=1 114 530 2.0E-108
sp|B0SSU3|PGK_LEPBP Phosphoglycerate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pgk PE=3 SV=1 122 527 2.0E-108
sp|B0SB21|PGK_LEPBA Phosphoglycerate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pgk PE=3 SV=1 122 527 2.0E-108
sp|A7ZEZ5|PGK_CAMC1 Phosphoglycerate kinase OS=Campylobacter concisus (strain 13826) GN=pgk PE=3 SV=1 120 527 3.0E-108
sp|A7NKY6|PGK_ROSCS Phosphoglycerate kinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pgk PE=3 SV=1 121 528 4.0E-108
sp|B9KFD9|PGK_CAMLR Phosphoglycerate kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=pgk PE=3 SV=1 120 530 5.0E-108
sp|Q30PQ4|PGK_SULDN Phosphoglycerate kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pgk PE=3 SV=1 120 527 6.0E-108
sp|B3E9Q7|PGK_GEOLS Phosphoglycerate kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pgk PE=3 SV=1 126 530 6.0E-108
sp|B2KC44|PGK_ELUMP Phosphoglycerate kinase OS=Elusimicrobium minutum (strain Pei191) GN=pgk PE=3 SV=1 114 528 1.0E-107
sp|A5CYN8|PGK_PELTS Phosphoglycerate kinase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pgk PE=3 SV=1 121 527 1.0E-107
sp|A9NHH8|PGK_ACHLI Phosphoglycerate kinase OS=Acholeplasma laidlawii (strain PG-8A) GN=pgk PE=3 SV=1 121 525 1.0E-107
sp|A9B312|PGK_HERA2 Phosphoglycerate kinase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pgk PE=3 SV=1 119 530 1.0E-107
sp|Q833I9|PGK_ENTFA Phosphoglycerate kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pgk PE=3 SV=1 119 530 1.0E-107
sp|P08966|PGKB_CRIFA Phosphoglycerate kinase, cytosolic OS=Crithidia fasciculata GN=PGKB PE=3 SV=1 114 530 2.0E-107
sp|P08893|PGKE_TRYBB Phosphoglycerate kinase, cytosolic OS=Trypanosoma brucei brucei PE=3 SV=1 114 530 3.0E-107
sp|P50312|PGKC_LEIMA Phosphoglycerate kinase, glycosomal OS=Leishmania major GN=PGKC PE=3 SV=1 114 530 4.0E-107
sp|Q5HT15|PGK_CAMJR Phosphoglycerate kinase OS=Campylobacter jejuni (strain RM1221) GN=pgk PE=3 SV=1 120 530 1.0E-106
sp|B2GAL8|PGK_LACF3 Phosphoglycerate kinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=pgk PE=3 SV=1 119 530 1.0E-106
sp|P07378|PGKC_TRYBB Phosphoglycerate kinase, glycosomal OS=Trypanosoma brucei brucei PE=1 SV=1 114 530 1.0E-106
sp|A8FN77|PGK_CAMJ8 Phosphoglycerate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=pgk PE=3 SV=1 120 530 2.0E-106
sp|Q59181|PGK_BORBU Phosphoglycerate kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pgk PE=3 SV=2 129 529 2.0E-106
sp|P08967|PGKC_CRIFA Phosphoglycerate kinase, glycosomal OS=Crithidia fasciculata GN=PGKC PE=3 SV=1 114 530 2.0E-106
sp|Q9PLN4|PGK_CHLMU Phosphoglycerate kinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pgk PE=3 SV=1 119 528 3.0E-106
sp|B7J0Z2|PGK_BORBZ Phosphoglycerate kinase OS=Borrelia burgdorferi (strain ZS7) GN=pgk PE=3 SV=1 129 529 3.0E-106
sp|Q88YH5|PGK_LACPL Phosphoglycerate kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pgk PE=3 SV=1 119 530 3.0E-106
sp|A7GWT1|PGK_CAMC5 Phosphoglycerate kinase OS=Campylobacter curvus (strain 525.92) GN=pgk PE=3 SV=1 120 527 3.0E-106
sp|B0S1H0|PGK_FINM2 Phosphoglycerate kinase OS=Finegoldia magna (strain ATCC 29328) GN=pgk PE=3 SV=1 119 530 4.0E-106
sp|Q9PMQ5|PGK_CAMJE Phosphoglycerate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pgk PE=1 SV=1 120 530 4.0E-106
sp|A1W116|PGK_CAMJJ Phosphoglycerate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pgk PE=3 SV=1 120 530 5.0E-106
sp|A7H5C5|PGK_CAMJD Phosphoglycerate kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pgk PE=3 SV=1 120 530 5.0E-106
sp|B2UKW8|PGK_AKKM8 Phosphoglycerate kinase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=pgk PE=3 SV=1 119 530 5.0E-106
sp|Q27685|PGKC_LEIME Phosphoglycerate kinase, glycosomal OS=Leishmania mexicana GN=PGKC PE=3 SV=1 114 530 5.0E-106
sp|Q7MU77|PGK_PORGI Phosphoglycerate kinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pgk PE=3 SV=1 120 528 6.0E-106
sp|A6LR05|PGK_CLOB8 Phosphoglycerate kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pgk PE=3 SV=1 118 528 4.0E-105
sp|A8YUE3|PGK_LACH4 Phosphoglycerate kinase OS=Lactobacillus helveticus (strain DPC 4571) GN=pgk PE=3 SV=1 119 530 4.0E-105
sp|P41760|PGK1_TRYCO Phosphoglycerate kinase, cytosolic OS=Trypanosoma congolense GN=C1PGK PE=3 SV=1 114 530 4.0E-105
sp|Q8A753|PGK_BACTN Phosphoglycerate kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pgk PE=3 SV=1 121 528 5.0E-105
sp|B8FJP4|PGK_DESAA Phosphoglycerate kinase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=pgk PE=3 SV=1 120 527 6.0E-105
sp|Q27684|PGKB_LEIME Phosphoglycerate kinase, cytosolic OS=Leishmania mexicana GN=PGKB PE=3 SV=1 114 531 6.0E-105
sp|Q5FL50|PGK_LACAC Phosphoglycerate kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pgk PE=3 SV=1 119 530 6.0E-105
sp|Q1IZA3|PGK_DEIGD Phosphoglycerate kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=pgk PE=3 SV=1 121 527 7.0E-105
sp|Q1AUH7|PGK_RUBXD Phosphoglycerate kinase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pgk PE=3 SV=1 121 530 8.0E-105
sp|Q928I0|PGK_LISIN Phosphoglycerate kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pgk PE=3 SV=1 116 530 1.0E-104
sp|Q7NI70|PGK_GLOVI Phosphoglycerate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=pgk PE=3 SV=1 126 527 1.0E-104
sp|Q71WW8|PGK_LISMF Phosphoglycerate kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pgk PE=3 SV=1 116 530 2.0E-104
sp|C1KY97|PGK_LISMC Phosphoglycerate kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pgk PE=3 SV=1 116 530 2.0E-104
sp|Q03IS8|PGK_STRTD Phosphoglycerate kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=pgk PE=3 SV=1 119 530 3.0E-104
sp|B8DD98|PGK_LISMH Phosphoglycerate kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pgk PE=3 SV=1 116 530 3.0E-104
sp|Q8VVB6|PGK_STRT2 Phosphoglycerate kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pgk PE=3 SV=1 119 530 3.0E-104
sp|A0RQT4|PGK_CAMFF Phosphoglycerate kinase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=pgk PE=3 SV=1 116 527 4.0E-104
sp|A7I1G1|PGK_CAMHC Phosphoglycerate kinase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=pgk PE=3 SV=1 120 530 4.0E-104
sp|A0ALE2|PGK_LISW6 Phosphoglycerate kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pgk PE=3 SV=1 116 530 5.0E-104
sp|Q5LY23|PGK_STRT1 Phosphoglycerate kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pgk PE=3 SV=1 119 530 5.0E-104
sp|B2G616|PGK_LACRJ Phosphoglycerate kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=pgk PE=3 SV=1 119 530 9.0E-104
sp|A1A1N3|PGK_BIFAA Phosphoglycerate kinase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pgk PE=3 SV=1 126 527 9.0E-104
sp|Q1WTB5|PGK_LACS1 Phosphoglycerate kinase OS=Lactobacillus salivarius (strain UCC118) GN=pgk PE=3 SV=1 119 530 2.0E-103
sp|Q03GW7|PGK_PEDPA Phosphoglycerate kinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=pgk PE=3 SV=1 119 530 2.0E-103
sp|Q8Y4I2|PGK_LISMO Phosphoglycerate kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pgk PE=3 SV=1 116 530 2.0E-103
sp|B3DRV9|PGK_BIFLD Phosphoglycerate kinase OS=Bifidobacterium longum (strain DJO10A) GN=pgk PE=3 SV=1 126 528 2.0E-103
sp|Q04G42|PGK_OENOB Phosphoglycerate kinase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=pgk PE=3 SV=1 119 530 2.0E-103
sp|B7GQU7|PGK_BIFLS Phosphoglycerate kinase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=pgk PE=3 SV=1 126 528 2.0E-103
sp|Q7WTU1|PGK_SPICI Phosphoglycerate kinase OS=Spiroplasma citri GN=pgk PE=3 SV=1 116 530 3.0E-103
sp|Q3KL01|PGK_CHLTA Phosphoglycerate kinase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=pgk PE=3 SV=1 119 528 4.0E-103
sp|P0CD78|PGK_CHLTR Phosphoglycerate kinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pgk PE=3 SV=1 119 528 5.0E-103
sp|Q8G6D6|PGK_BIFLO Phosphoglycerate kinase OS=Bifidobacterium longum (strain NCC 2705) GN=pgk PE=3 SV=2 126 528 5.0E-103
sp|Q38Y20|PGK_LACSS Phosphoglycerate kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pgk PE=3 SV=1 116 530 6.0E-103
sp|B0BAE8|PGK_CHLTB Phosphoglycerate kinase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=pgk PE=3 SV=1 119 528 6.0E-103
sp|B0B8R9|PGK_CHLT2 Phosphoglycerate kinase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=pgk PE=3 SV=1 119 528 6.0E-103
sp|A8AUR9|PGK_STRGC Phosphoglycerate kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pgk PE=3 SV=1 119 530 1.0E-102
sp|B4U8G5|PGK_HYDS0 Phosphoglycerate kinase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=pgk PE=3 SV=1 116 530 1.0E-102
sp|P62415|PGK_MYCMS Phosphoglycerate kinase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=pgk PE=3 SV=1 114 530 3.0E-102
sp|P62413|PGK_LACJO Phosphoglycerate kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pgk PE=3 SV=1 119 530 3.0E-102
sp|A4VSN8|PGK_STRSY Phosphoglycerate kinase OS=Streptococcus suis (strain 05ZYH33) GN=pgk PE=3 SV=1 119 530 5.0E-102
sp|A4VYY1|PGK_STRS2 Phosphoglycerate kinase OS=Streptococcus suis (strain 98HAH33) GN=pgk PE=3 SV=1 119 530 5.0E-102
sp|A3CKQ4|PGK_STRSV Phosphoglycerate kinase OS=Streptococcus sanguinis (strain SK36) GN=pgk PE=3 SV=1 119 530 9.0E-102
sp|Q8RFN7|PGK_FUSNN Phosphoglycerate kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pgk PE=3 SV=1 122 530 1.0E-101
sp|C0M940|PGK_STRE4 Phosphoglycerate kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=pgk PE=3 SV=1 119 530 2.0E-101
sp|Q042F2|PGK_LACGA Phosphoglycerate kinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=pgk PE=3 SV=1 119 530 2.0E-101
sp|Q252S3|PGK_CHLFF Phosphoglycerate kinase OS=Chlamydophila felis (strain Fe/C-56) GN=pgk PE=3 SV=1 119 528 2.0E-101
sp|Q8DQX8|PGK_STRR6 Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgk PE=1 SV=1 119 530 5.0E-101
sp|Q04LZ5|PGK_STRP2 Phosphoglycerate kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pgk PE=1 SV=1 119 530 5.0E-101
sp|Q97S89|PGK_STRPN Phosphoglycerate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pgk PE=3 SV=1 119 530 5.0E-101
sp|C1CQ04|PGK_STRZT Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|C1CIZ1|PGK_STRZP Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain P1031) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|C1CCP3|PGK_STRZJ Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain JJA) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|B2IMA2|PGK_STRPS Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|B8ZLX5|PGK_STRPJ Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|B1IA36|PGK_STRPI Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|C1C5M3|PGK_STRP7 Phosphoglycerate kinase OS=Streptococcus pneumoniae (strain 70585) GN=pgk PE=3 SV=1 119 530 7.0E-101
sp|C0MF22|PGK_STRS7 Phosphoglycerate kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pgk PE=3 SV=1 119 530 1.0E-100
sp|B5E1U9|PGK_STRP4 Phosphoglycerate kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pgk PE=3 SV=1 119 530 1.0E-100
sp|Q8E3F0|PGK_STRA3 Phosphoglycerate kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pgk PE=3 SV=1 119 530 1.0E-100
sp|B9DVS0|PGK_STRU0 Phosphoglycerate kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pgk PE=3 SV=1 119 530 2.0E-100
sp|A8ZUS4|PGK_DESOH Phosphoglycerate kinase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=pgk PE=3 SV=1 121 528 3.0E-100
sp|Q8DVV2|PGK_STRMU Phosphoglycerate kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pgk PE=3 SV=1 119 530 4.0E-100
sp|Q5L748|PGK_CHLAB Phosphoglycerate kinase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=pgk PE=3 SV=1 119 528 4.0E-100
sp|P0DD05|PGK_STRPQ Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pgk PE=3 SV=1 119 530 4.0E-100
sp|Q48RF9|PGK_STRPM Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pgk PE=3 SV=1 119 530 4.0E-100
sp|Q1J4X9|PGK_STRPF Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pgk PE=3 SV=1 119 530 4.0E-100
sp|P0DD04|PGK_STRP3 Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pgk PE=3 SV=1 119 530 4.0E-100
sp|B4U0W3|PGK_STREM Phosphoglycerate kinase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=pgk PE=3 SV=1 119 530 4.0E-100
sp|Q8DXT0|PGK_STRA5 Phosphoglycerate kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pgk PE=3 SV=1 119 530 5.0E-100
sp|Q3JZB8|PGK_STRA1 Phosphoglycerate kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pgk PE=3 SV=1 119 530 5.0E-100
sp|Q8GIZ5|PGK_LACDL Phosphoglycerate kinase OS=Lactobacillus delbrueckii subsp. lactis GN=pgk PE=3 SV=1 119 530 5.0E-100
sp|A0LJZ1|PGK_SYNFM Phosphoglycerate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pgk PE=3 SV=1 121 528 1.0E-99
sp|Q1JK32|PGK_STRPC Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pgk PE=3 SV=1 119 530 1.0E-99
sp|Q1J9Y4|PGK_STRPB Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pgk PE=3 SV=1 119 530 1.0E-99
sp|Q5XA18|PGK_STRP6 Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pgk PE=1 SV=3 119 530 1.0E-99
sp|P68897|PGK_STRP1 Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M1 GN=pgk PE=3 SV=2 119 530 1.0E-99
sp|B5XIF1|PGK_STRPZ Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=pgk PE=3 SV=1 119 530 1.0E-99
sp|Q824S8|PGK_CHLCV Phosphoglycerate kinase OS=Chlamydophila caviae (strain GPIC) GN=pgk PE=3 SV=1 119 528 1.0E-99
sp|Q7VJB6|PGK_HELHP Phosphoglycerate kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=pgk PE=3 SV=1 121 530 2.0E-99
sp|Q8NZG3|PGK_STRP8 Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pgk PE=3 SV=2 119 530 2.0E-99
sp|A2RCM1|PGK_STRPG Phosphoglycerate kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=pgk PE=3 SV=1 119 530 2.0E-99
sp|B2S3D0|PGK_TREPS Phosphoglycerate kinase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=pgk PE=3 SV=1 121 529 1.0E-98
sp|O83549|PGK_TREPA Phosphoglycerate kinase OS=Treponema pallidum (strain Nichols) GN=pgk PE=3 SV=1 121 529 1.0E-98
sp|B5Y8I0|PGK_COPPD Phosphoglycerate kinase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pgk PE=3 SV=1 121 527 1.0E-98
sp|P68821|PGK_STAAW Phosphoglycerate kinase OS=Staphylococcus aureus (strain MW2) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|P68820|PGK_STAAU Phosphoglycerate kinase OS=Staphylococcus aureus GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|A8Z1A1|PGK_STAAT Phosphoglycerate kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|Q6GB57|PGK_STAAS Phosphoglycerate kinase OS=Staphylococcus aureus (strain MSSA476) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|Q6GIL7|PGK_STAAR Phosphoglycerate kinase OS=Staphylococcus aureus (strain MRSA252) GN=pgk PE=1 SV=1 116 530 2.0E-98
sp|P99135|PGK_STAAN Phosphoglycerate kinase OS=Staphylococcus aureus (strain N315) GN=pgk PE=1 SV=1 116 530 2.0E-98
sp|P68819|PGK_STAAM Phosphoglycerate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|A6QF82|PGK_STAAE Phosphoglycerate kinase OS=Staphylococcus aureus (strain Newman) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|Q5HHP4|PGK_STAAC Phosphoglycerate kinase OS=Staphylococcus aureus (strain COL) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|A5IQX7|PGK_STAA9 Phosphoglycerate kinase OS=Staphylococcus aureus (strain JH9) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|Q2G031|PGK_STAA8 Phosphoglycerate kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|Q2FIM0|PGK_STAA3 Phosphoglycerate kinase OS=Staphylococcus aureus (strain USA300) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|A6TZQ2|PGK_STAA2 Phosphoglycerate kinase OS=Staphylococcus aureus (strain JH1) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|A7WZS6|PGK_STAA1 Phosphoglycerate kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pgk PE=3 SV=1 116 530 2.0E-98
sp|B9EAG8|PGK_MACCJ Phosphoglycerate kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=pgk PE=3 SV=1 122 530 2.0E-98
sp|C6BUI7|PGK_DESAD Phosphoglycerate kinase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=pgk PE=3 SV=1 122 527 2.0E-98
sp|Q2YSF1|PGK_STAAB Phosphoglycerate kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pgk PE=3 SV=1 116 530 5.0E-98
sp|Q9Z7M5|PGK_CHLPN Phosphoglycerate kinase OS=Chlamydia pneumoniae GN=pgk PE=3 SV=1 119 528 8.0E-98
sp|P62411|PGK_CORDI Phosphoglycerate kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pgk PE=3 SV=1 127 529 9.0E-98
sp|Q9RUP2|PGK_DEIRA Phosphoglycerate kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pgk PE=3 SV=1 108 528 1.0E-97
sp|Q5YTQ5|PGK_NOCFA Phosphoglycerate kinase OS=Nocardia farcinica (strain IFM 10152) GN=pgk PE=3 SV=1 127 527 1.0E-97
sp|Q9CIW1|PGK_LACLA Phosphoglycerate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pgk PE=3 SV=1 119 530 2.0E-97
sp|Q032K6|PGK_LACLS Phosphoglycerate kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pgk PE=3 SV=1 119 530 4.0E-97
sp|O32756|PGK_LACDE Phosphoglycerate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pgk PE=3 SV=1 119 530 4.0E-97
sp|Q04BH1|PGK_LACDB Phosphoglycerate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=pgk PE=3 SV=1 119 530 4.0E-97
sp|Q1GB26|PGK_LACDA Phosphoglycerate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pgk PE=3 SV=1 119 530 4.0E-97
sp|A2RHX1|PGK_LACLM Phosphoglycerate kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pgk PE=3 SV=1 119 530 4.0E-97
sp|Q0RH06|PGK_FRAAA Phosphoglycerate kinase OS=Frankia alni (strain ACN14a) GN=pgk PE=3 SV=1 121 527 1.0E-96
sp|Q7M9C1|PGK_WOLSU Phosphoglycerate kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=pgk PE=3 SV=1 121 530 1.0E-96
sp|B9DJJ6|PGK_STACT Phosphoglycerate kinase OS=Staphylococcus carnosus (strain TM300) GN=pgk PE=3 SV=1 122 530 1.0E-96
sp|B1I0X7|PGK_DESAP Phosphoglycerate kinase OS=Desulforudis audaxviator (strain MP104C) GN=pgk PE=3 SV=1 121 530 2.0E-96
sp|Q2S3A7|PGK_SALRD Phosphoglycerate kinase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pgk PE=3 SV=1 118 528 3.0E-96
sp|C0Q9Z7|PGK_DESAH Phosphoglycerate kinase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=pgk PE=3 SV=1 121 527 3.0E-94
sp|Q49W00|PGK_STAS1 Phosphoglycerate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pgk PE=3 SV=1 116 530 5.0E-94
sp|Q89U95|PGK_BRADU Phosphoglycerate kinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pgk PE=3 SV=1 121 530 7.0E-94
sp|Q4L4K4|PGK_STAHJ Phosphoglycerate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pgk PE=3 SV=1 116 530 2.0E-93
sp|A4IWY7|PGK_FRATW Phosphoglycerate kinase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pgk PE=3 SV=1 120 530 3.0E-93
sp|Q5NF76|PGK_FRATT Phosphoglycerate kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pgk PE=1 SV=1 120 530 3.0E-93
sp|Q14GM9|PGK_FRAT1 Phosphoglycerate kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pgk PE=3 SV=1 120 530 3.0E-93
sp|Q0BLP2|PGK_FRATO Phosphoglycerate kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pgk PE=3 SV=1 120 530 7.0E-93
sp|Q2A369|PGK_FRATH Phosphoglycerate kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pgk PE=3 SV=1 120 530 7.0E-93
sp|A7NCI3|PGK_FRATF Phosphoglycerate kinase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pgk PE=3 SV=1 120 530 7.0E-93
sp|Q2JCH8|PGK_FRASC Phosphoglycerate kinase OS=Frankia sp. (strain CcI3) GN=pgk PE=3 SV=1 121 527 7.0E-93
sp|Q8CTD6|PGK_STAES Phosphoglycerate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pgk PE=3 SV=1 116 530 8.0E-93
sp|Q5HQV3|PGK_STAEQ Phosphoglycerate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pgk PE=3 SV=1 116 530 8.0E-93
sp|C1B4L7|PGK_RHOOB Phosphoglycerate kinase OS=Rhodococcus opacus (strain B4) GN=pgk PE=3 SV=1 127 527 1.0E-92
sp|Q606J5|PGK_METCA Phosphoglycerate kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pgk PE=3 SV=1 124 530 1.0E-92
sp|B2SFU7|PGK_FRATM Phosphoglycerate kinase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pgk PE=3 SV=1 120 530 2.0E-92
sp|Q0S0J4|PGK_RHOJR Phosphoglycerate kinase OS=Rhodococcus jostii (strain RHA1) GN=pgk PE=3 SV=1 127 528 2.0E-92
sp|A4FBM5|PGK_SACEN Phosphoglycerate kinase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pgk PE=3 SV=1 127 527 5.0E-92
sp|A0QWW3|PGK_MYCS2 Phosphoglycerate kinase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pgk PE=1 SV=1 127 529 1.0E-91
sp|A0Q7J1|PGK_FRATN Phosphoglycerate kinase OS=Francisella tularensis subsp. novicida (strain U112) GN=pgk PE=3 SV=1 120 530 2.0E-91
sp|A9W5A7|PGK_METEP Phosphoglycerate kinase OS=Methylobacterium extorquens (strain PA1) GN=pgk PE=3 SV=1 121 530 2.0E-91
sp|C5CBP5|PGK_MICLC Phosphoglycerate kinase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=pgk PE=3 SV=1 127 528 2.0E-91
sp|B7KNP6|PGK_METC4 Phosphoglycerate kinase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pgk PE=3 SV=1 121 530 3.0E-91
sp|A4QEG1|PGK_CORGB Phosphoglycerate kinase OS=Corynebacterium glutamicum (strain R) GN=pgk PE=3 SV=1 124 528 4.0E-91
sp|Q8FT66|PGK_COREF Phosphoglycerate kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pgk PE=3 SV=1 124 527 1.0E-90
sp|B1Z980|PGK_METPB Phosphoglycerate kinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pgk PE=3 SV=1 121 530 3.0E-90
sp|Q01655|PGK_CORGL Phosphoglycerate kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pgk PE=3 SV=2 124 528 3.0E-90
sp|A1T8L1|PGK_MYCVP Phosphoglycerate kinase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pgk PE=3 SV=1 121 527 4.0E-90
sp|A5CRT6|PGK_CLAM3 Phosphoglycerate kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=pgk PE=3 SV=1 126 527 4.0E-90
sp|C5BV35|PGK_BEUC1 Phosphoglycerate kinase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=pgk PE=3 SV=1 121 527 4.0E-90
sp|A7IJW3|PGK_XANP2 Phosphoglycerate kinase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pgk PE=3 SV=1 121 527 7.0E-90
sp|Q6FYN4|PGK_BARQU Phosphoglycerate kinase OS=Bartonella quintana (strain Toulouse) GN=pgk PE=3 SV=1 121 527 1.0E-89
sp|Q8L1Z8|PGK_BARHE Phosphoglycerate kinase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pgk PE=3 SV=1 121 528 1.0E-89
sp|C1CV29|PGK_DEIDV Phosphoglycerate kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pgk PE=3 SV=1 121 527 1.0E-89
sp|A8KYR5|PGK_FRASN Phosphoglycerate kinase OS=Frankia sp. (strain EAN1pec) GN=pgk PE=3 SV=1 121 527 2.0E-89
sp|C0ZZF3|PGK_RHOE4 Phosphoglycerate kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=pgk PE=3 SV=1 124 528 2.0E-89
sp|P50314|PGK_XANFL Phosphoglycerate kinase OS=Xanthobacter flavus GN=pgk PE=3 SV=1 116 527 3.0E-89
sp|B0TY21|PGK_FRAP2 Phosphoglycerate kinase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pgk PE=3 SV=1 120 530 6.0E-89
sp|A8H0N0|PGK_SHEPA Phosphoglycerate kinase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pgk PE=3 SV=1 120 530 8.0E-89
sp|A8IM75|PGK_AZOC5 Phosphoglycerate kinase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pgk PE=3 SV=1 121 527 9.0E-89
sp|B0REJ2|PGK_CLAMS Phosphoglycerate kinase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=pgk PE=3 SV=1 126 527 1.0E-88
sp|P62419|PGK_RHOPA Phosphoglycerate kinase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pgk PE=3 SV=1 121 530 2.0E-88
sp|P62420|PGK_THET2 Phosphoglycerate kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pgk PE=3 SV=1 124 528 2.0E-88
sp|P09403|PGK_THET8 Phosphoglycerate kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pgk PE=1 SV=3 124 528 2.0E-88
sp|C4LIR6|PGK_CORK4 Phosphoglycerate kinase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=pgk PE=3 SV=1 127 527 2.0E-88
sp|Q0VL87|PGK_ALCBS Phosphoglycerate kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pgk PE=3 SV=1 124 530 4.0E-88
sp|Q7UEX1|PGK_RHOBA Phosphoglycerate kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pgk PE=3 SV=1 119 527 4.0E-88
sp|B6IWR7|PGK_RHOCS Phosphoglycerate kinase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pgk PE=3 SV=1 121 527 4.0E-88
sp|Q1B9C1|PGK_MYCSS Phosphoglycerate kinase OS=Mycobacterium sp. (strain MCS) GN=pgk PE=3 SV=1 124 529 5.0E-88
sp|A1UFP0|PGK_MYCSK Phosphoglycerate kinase OS=Mycobacterium sp. (strain KMS) GN=pgk PE=3 SV=1 124 529 5.0E-88
sp|A3PZA2|PGK_MYCSJ Phosphoglycerate kinase OS=Mycobacterium sp. (strain JLS) GN=pgk PE=3 SV=1 124 529 5.0E-88
sp|Q5FTL1|PGK_GLUOX Phosphoglycerate kinase OS=Gluconobacter oxydans (strain 621H) GN=pgk PE=3 SV=1 121 529 6.0E-88
sp|B8J4D3|PGK_DESDA Phosphoglycerate kinase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pgk PE=3 SV=1 122 530 9.0E-88
sp|C3PG40|PGK_CORA7 Phosphoglycerate kinase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=pgk PE=3 SV=1 127 528 1.0E-87
sp|P56154|PGK_HELPY Phosphoglycerate kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pgk PE=3 SV=1 121 530 1.0E-87
sp|A9IYR6|PGK_BART1 Phosphoglycerate kinase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pgk PE=3 SV=1 121 527 1.0E-87
sp|A4TC15|PGK_MYCGI Phosphoglycerate kinase OS=Mycobacterium gilvum (strain PYR-GCK) GN=pgk PE=3 SV=1 121 528 2.0E-87
sp|Q9ZJP1|PGK_HELPJ Phosphoglycerate kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pgk PE=3 SV=1 121 530 2.0E-87
sp|A4XPG4|PGK_PSEMY Phosphoglycerate kinase OS=Pseudomonas mendocina (strain ymp) GN=pgk PE=3 SV=1 120 530 3.0E-87
sp|A4XDR3|PGK_SALTO Phosphoglycerate kinase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pgk PE=3 SV=1 121 529 4.0E-87
sp|Q4JVJ3|PGK_CORJK Phosphoglycerate kinase OS=Corynebacterium jeikeium (strain K411) GN=pgk PE=3 SV=1 127 529 4.0E-87
sp|B9KZ66|PGK_THERP Phosphoglycerate kinase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=pgk PE=3 SV=1 121 527 2.0E-86
sp|B1VDQ4|PGK_CORU7 Phosphoglycerate kinase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=pgk PE=3 SV=1 127 527 5.0E-86
sp|B7V4D9|PGK_PSEA8 Phosphoglycerate kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=pgk PE=3 SV=1 120 530 6.0E-86
sp|A3QAX8|PGK_SHELP Phosphoglycerate kinase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pgk PE=3 SV=1 120 530 1.0E-85
sp|B2HP85|PGK_MYCMM Phosphoglycerate kinase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pgk PE=3 SV=1 127 527 2.0E-85
sp|Q9Z519|PGK_STRCO Phosphoglycerate kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pgk PE=3 SV=1 127 528 2.0E-85
sp|A8LW18|PGK_SALAI Phosphoglycerate kinase OS=Salinispora arenicola (strain CNS-205) GN=pgk PE=3 SV=1 121 528 2.0E-85
sp|A8FRL4|PGK_SHESH Phosphoglycerate kinase OS=Shewanella sediminis (strain HAW-EB3) GN=pgk PE=3 SV=1 120 530 4.0E-85
sp|Q3ILL7|PGK_PSEHT Phosphoglycerate kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pgk PE=3 SV=1 124 530 4.0E-85
sp|Q15QK4|PGK_PSEA6 Phosphoglycerate kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pgk PE=3 SV=1 120 530 4.0E-85
sp|B1M787|PGK_METRJ Phosphoglycerate kinase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=pgk PE=3 SV=1 114 530 5.0E-85
sp|Q6A9J3|PGK_PROAC Phosphoglycerate kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pgk PE=3 SV=1 121 527 5.0E-85
sp|Q9I5Y4|PGK_PSEAE Phosphoglycerate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pgk PE=3 SV=1 120 530 5.0E-85
sp|Q02TL3|PGK_PSEAB Phosphoglycerate kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pgk PE=3 SV=1 120 530 5.0E-85
sp|Q12QA3|PGK_SHEDO Phosphoglycerate kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pgk PE=3 SV=1 120 530 7.0E-85
sp|Q3J7E3|PGK_NITOC Phosphoglycerate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pgk PE=3 SV=1 120 530 7.0E-85
sp|A6W3D3|PGK_MARMS Phosphoglycerate kinase OS=Marinomonas sp. (strain MWYL1) GN=pgk PE=3 SV=1 120 530 1.0E-84
sp|Q8YIY0|PGK_BRUME Phosphoglycerate kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pgk PE=3 SV=2 121 527 1.0E-84
sp|Q9L560|PGK_BRUAB Phosphoglycerate kinase OS=Brucella abortus biovar 1 (strain 9-941) GN=pgk PE=3 SV=2 121 527 2.0E-84
sp|B8GP44|PGK_THISH Phosphoglycerate kinase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=pgk PE=3 SV=1 120 530 2.0E-84
sp|A1U543|PGK_MARHV Phosphoglycerate kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pgk PE=3 SV=1 124 530 2.0E-84
sp|A6UZ15|PGK_PSEA7 Phosphoglycerate kinase OS=Pseudomonas aeruginosa (strain PA7) GN=pgk PE=3 SV=1 120 530 3.0E-84
sp|C3K3F1|PGK_PSEFS Phosphoglycerate kinase OS=Pseudomonas fluorescens (strain SBW25) GN=pgk PE=3 SV=1 120 530 3.0E-84
sp|B0TUC1|PGK_SHEHH Phosphoglycerate kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pgk PE=3 SV=1 120 530 3.0E-84
sp|A0PPN3|PGK_MYCUA Phosphoglycerate kinase OS=Mycobacterium ulcerans (strain Agy99) GN=pgk PE=3 SV=1 127 527 6.0E-84
sp|Q0A4Q5|PGK_ALKEH Phosphoglycerate kinase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pgk PE=3 SV=1 120 530 6.0E-84
sp|Q4K4J1|PGK_PSEF5 Phosphoglycerate kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pgk PE=3 SV=1 120 530 9.0E-84
sp|B1W0Z3|PGK_STRGG Phosphoglycerate kinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pgk PE=3 SV=1 127 527 1.0E-83
sp|Q8P5Z4|PGK_XANCP Phosphoglycerate kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pgk PE=3 SV=1 114 530 1.0E-83
sp|B0RPF1|PGK_XANCB Phosphoglycerate kinase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pgk PE=3 SV=1 114 530 1.0E-83
sp|Q4UY23|PGK_XANC8 Phosphoglycerate kinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pgk PE=3 SV=1 114 530 1.0E-83
sp|Q11CR7|PGK_CHESB Phosphoglycerate kinase OS=Chelativorans sp. (strain BNC1) GN=pgk PE=3 SV=1 121 528 2.0E-83
sp|B9JS00|PGK_AGRVS Phosphoglycerate kinase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pgk PE=3 SV=1 121 528 2.0E-83
sp|Q829W2|PGK_STRAW Phosphoglycerate kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pgk PE=3 SV=1 127 528 2.0E-83
sp|A6UCV3|PGK_SINMW Phosphoglycerate kinase OS=Sinorhizobium medicae (strain WSM419) GN=pgk PE=3 SV=1 121 530 2.0E-83
sp|B8E5U4|PGK_SHEB2 Phosphoglycerate kinase OS=Shewanella baltica (strain OS223) GN=pgk PE=3 SV=1 120 530 2.0E-83
sp|Q3K5F2|PGK_PSEPF Phosphoglycerate kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pgk PE=3 SV=1 120 530 3.0E-83
sp|Q8FYX8|PGK_BRUSU Phosphoglycerate kinase OS=Brucella suis biovar 1 (strain 1330) GN=pgk PE=3 SV=1 121 527 3.0E-83
sp|Q0BVE2|PGK_GRABC Phosphoglycerate kinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pgk PE=3 SV=1 121 527 3.0E-83
sp|Q1I3Y0|PGK_PSEE4 Phosphoglycerate kinase OS=Pseudomonas entomophila (strain L48) GN=pgk PE=3 SV=1 120 530 4.0E-83
sp|C1DKE9|PGK_AZOVD Phosphoglycerate kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pgk PE=3 SV=1 120 530 4.0E-83
sp|P62417|PGK_ONYPE Phosphoglycerate kinase OS=Onion yellows phytoplasma (strain OY-M) GN=pgk PE=3 SV=1 121 527 4.0E-83
sp|P9WID1|PGK_MYCTU Phosphoglycerate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pgk PE=1 SV=1 127 528 5.0E-83
sp|P9WID0|PGK_MYCTO Phosphoglycerate kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pgk PE=3 SV=1 127 528 5.0E-83
sp|A5U2D9|PGK_MYCTA Phosphoglycerate kinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pgk PE=3 SV=1 127 528 5.0E-83
sp|C1AN82|PGK_MYCBT Phosphoglycerate kinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pgk PE=3 SV=1 127 528 5.0E-83
sp|A1KIM6|PGK_MYCBP Phosphoglycerate kinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pgk PE=3 SV=1 127 528 5.0E-83
sp|P65701|PGK_MYCBO Phosphoglycerate kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pgk PE=3 SV=1 127 528 5.0E-83
sp|A9L1M3|PGK_SHEB9 Phosphoglycerate kinase OS=Shewanella baltica (strain OS195) GN=pgk PE=3 SV=1 120 530 6.0E-83
sp|P62422|PGK_WOLPM Phosphoglycerate kinase OS=Wolbachia pipientis wMel GN=pgk PE=3 SV=1 121 530 6.0E-83
sp|B2FSF3|PGK_STRMK Phosphoglycerate kinase OS=Stenotrophomonas maltophilia (strain K279a) GN=pgk PE=3 SV=1 114 530 7.0E-83
sp|Q87AH8|PGK_XYLFT Phosphoglycerate kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pgk PE=3 SV=1 114 530 9.0E-83
sp|B1MC86|PGK_MYCA9 Phosphoglycerate kinase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pgk PE=3 SV=1 127 527 1.0E-82
sp|Q83AU6|PGK_COXBU Phosphoglycerate kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pgk PE=1 SV=1 122 530 1.0E-82
sp|Q47XD4|PGK_COLP3 Phosphoglycerate kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pgk PE=3 SV=1 124 530 1.0E-82
sp|Q8PHB2|PGK_XANAC Phosphoglycerate kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pgk PE=3 SV=1 114 530 2.0E-82
sp|A9WT63|PGK_RENSM Phosphoglycerate kinase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=pgk PE=3 SV=1 127 527 2.0E-82
sp|Q087Q6|PGK_SHEFN Phosphoglycerate kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pgk PE=3 SV=1 120 530 3.0E-82
sp|B1KF21|PGK_SHEWM Phosphoglycerate kinase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pgk PE=3 SV=1 120 530 3.0E-82
sp|Q92M79|PGK_RHIME Phosphoglycerate kinase OS=Rhizobium meliloti (strain 1021) GN=pgk PE=3 SV=1 121 530 4.0E-82
sp|Q9PF55|PGK_XYLFA Phosphoglycerate kinase OS=Xylella fastidiosa (strain 9a5c) GN=pgk PE=3 SV=2 114 530 5.0E-82
sp|A1R6H1|PGK_ARTAT Phosphoglycerate kinase OS=Arthrobacter aurescens (strain TC1) GN=pgk PE=3 SV=1 127 527 7.0E-82
sp|A1UR75|PGK_BARBK Phosphoglycerate kinase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pgk PE=3 SV=1 121 527 7.0E-82
sp|Q5LR94|PGK_RUEPO Phosphoglycerate kinase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pgk PE=3 SV=1 121 527 9.0E-82
sp|B8CU40|PGK_SHEPW Phosphoglycerate kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pgk PE=3 SV=1 120 530 1.0E-81
sp|Q1GHP9|PGK_RUEST Phosphoglycerate kinase OS=Ruegeria sp. (strain TM1040) GN=pgk PE=3 SV=1 121 529 1.0E-81
sp|A1K9F0|PGK_AZOSB Phosphoglycerate kinase OS=Azoarcus sp. (strain BH72) GN=pgk PE=3 SV=1 124 531 1.0E-81
sp|P41762|PGKG_TRYCO Phosphoglycerate kinase, glycosomal OS=Trypanosoma congolense GN=56PGK PE=3 SV=1 170 527 2.0E-81
sp|A1WVV5|PGK_HALHL Phosphoglycerate kinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pgk PE=3 SV=1 117 528 2.0E-81
sp|Q7VZB8|PGK_BORPE Phosphoglycerate kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pgk PE=3 SV=1 127 530 2.0E-81
sp|Q8EIB1|PGK_SHEON Phosphoglycerate kinase OS=Shewanella oneidensis (strain MR-1) GN=pgk PE=3 SV=1 120 530 2.0E-81
sp|Q1GZ23|PGK_METFK Phosphoglycerate kinase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pgk PE=3 SV=1 120 530 2.0E-81
sp|B1J302|PGK_PSEPW Phosphoglycerate kinase OS=Pseudomonas putida (strain W619) GN=pgk PE=3 SV=1 120 530 2.0E-81
sp|C0R4J5|PGK_WOLWR Phosphoglycerate kinase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=pgk PE=3 SV=1 121 530 2.0E-81
sp|A4Y3S0|PGK_SHEPC Phosphoglycerate kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pgk PE=3 SV=1 120 530 3.0E-81
sp|Q5GXA2|PGK_XANOR Phosphoglycerate kinase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pgk PE=3 SV=1 114 530 3.0E-81
sp|Q2P0F7|PGK_XANOM Phosphoglycerate kinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pgk PE=3 SV=1 114 530 3.0E-81
sp|B2SI21|PGK_XANOP Phosphoglycerate kinase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=pgk PE=3 SV=1 114 530 3.0E-81
sp|P62410|PGK_BDEBA Phosphoglycerate kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pgk PE=3 SV=1 121 530 3.0E-81
sp|B4STV2|PGK_STRM5 Phosphoglycerate kinase OS=Stenotrophomonas maltophilia (strain R551-3) GN=pgk PE=3 SV=1 114 530 5.0E-81
sp|Q3BPW7|PGK_XANC5 Phosphoglycerate kinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pgk PE=3 SV=1 114 530 5.0E-81
sp|A6WS76|PGK_SHEB8 Phosphoglycerate kinase OS=Shewanella baltica (strain OS185) GN=pgk PE=3 SV=1 120 530 7.0E-81
sp|B0SUL9|PGK_CAUSK Phosphoglycerate kinase OS=Caulobacter sp. (strain K31) GN=pgk PE=3 SV=1 121 527 8.0E-81
sp|A3D0U1|PGK_SHEB5 Phosphoglycerate kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pgk PE=3 SV=1 120 530 9.0E-81
sp|A0L0K6|PGK_SHESA Phosphoglycerate kinase OS=Shewanella sp. (strain ANA-3) GN=pgk PE=3 SV=1 120 530 1.0E-80
sp|P41762|PGKG_TRYCO Phosphoglycerate kinase, glycosomal OS=Trypanosoma congolense GN=56PGK PE=3 SV=1 121 183 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006096 glycolytic process Yes
GO:0004618 phosphoglycerate kinase activity Yes
GO:0009056 catabolic process No
GO:0006082 organic acid metabolic process No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046939 nucleotide phosphorylation No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0016052 carbohydrate catabolic process No
GO:0006757 ATP generation from ADP No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016310 phosphorylation No
GO:0043436 oxoacid metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0046031 ADP metabolic process No
GO:0008152 metabolic process No
GO:0009132 nucleoside diphosphate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009259 ribonucleotide metabolic process No
GO:0009987 cellular process No
GO:0016774 phosphotransferase activity, carboxyl group as acceptor No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0008150 biological_process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:0046034 ATP metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0003674 molecular_function No
GO:0006163 purine nucleotide metabolic process No
GO:0006090 pyruvate metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0009117 nucleotide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17
2 39 58 19
3 78 100 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5082
MSALRRRQTAMSILGRICVIFYVLARSTVSTDRGLDNAAFTIAVCSMILEEAGLLSLLADAFWPRRPSVLWAARS
LDFIGLVVFSGLRKAVIVAFFNSVGYGMRCAIPYRHIFMSLARRLSVDDVDVKGKRVLIRVDFNVPLDDDNKITN
NQRIVGAVPTIKHALDHGAKAIILMSHLGRPNGSVNLKYSLKPVVAELEKLLAKPVKLAPDCVGPEVEAIVADAD
NGAVILLENLRFHIEEEGSAKDKDGNKLKADKDKVDAFRKGLTALGDIYINDAFGTAHRAHSSMVGVDLRQKVAG
FLMKKELDYFSKALDNPTPPFLAILGGAKVSDKIQLIDNLLDKVNSLIICGGMAFTFKKVLDNMPIGNSLFDEAG
SEMVPRLMEKAKAKKVKVVLPVDFIIADKFAKDAATGKATDKDGIPDGWMGLDCGEQSVALFKEAINEAKTILWN
GPAGVFEFDKFASGTKATLDAVVAACAKGNIVVIGGGDTATVAAKYGVEDKISHVSTGGGASLELLEGKQLPGIE
ALSTRWM*
Coding >Ophun1|5082
ATGTCGGCCCTGCGCCGCCGTCAGACGGCGATGTCTATACTCGGGCGGATCTGTGTTATCTTCTACGTGCTCGCA
AGGTCCACCGTCTCGACCGACCGAGGCCTCGACAACGCCGCCTTCACCATCGCGGTCTGCTCTATGATTCTTGAG
GAGGCAGGGCTCCTCAGCCTCCTGGCCGACGCCTTCTGGCCGCGTCGCCCATCAGTTCTGTGGGCGGCGCGGTCG
CTCGACTTTATCGGCCTCGTCGTCTTCTCCGGCCTCAGAAAGGCCGTCATCGTCGCGTTCTTCAACTCCGTGGGC
TATGGCATGCGTTGCGCCATCCCCTATCGCCACATCTTCATGTCTCTCGCTCGGAGGCTGTCCGTCGACGACGTC
GACGTCAAGGGAAAACGGGTCCTCATCCGGGTCGACTTCAACGTGCCTCTGGACGACGACAATAAGATCACCAAC
AACCAGCGCATCGTTGGCGCCGTCCCTACCATCAAGCATGCCCTCGACCATGGTGCCAAGGCCATCATCCTCATG
TCGCATCTCGGTCGGCCAAATGGAAGCGTCAACTTGAAATACTCCCTCAAGCCCGTCGTGGCCGAGCTCGAGAAG
CTCCTCGCCAAGCCCGTCAAGCTGGCTCCGGACTGTGTCGGACCAGAAGTCGAGGCCATTGTCGCCGATGCCGAC
AACGGCGCCGTCATCTTACTCGAGAACCTGCGCTTCCATATCGAGGAAGAGGGCAGCGCCAAGGACAAGGACGGA
AACAAGCTCAAGGCGGACAAGGACAAGGTCGACGCCTTTCGCAAGGGCCTGACGGCGCTTGGAGACATCTACATC
AATGACGCTTTCGGGACGGCTCACCGTGCTCACTCGTCCATGGTGGGCGTTGACCTGCGTCAGAAGGTAGCAGGA
TTCCTCATGAAGAAAGAGCTCGATTACTTTTCCAAGGCCCTCGATAACCCGACACCCCCGTTTCTGGCCATCCTT
GGCGGCGCCAAAGTTTCGGACAAGATCCAACTCATTGACAACCTGCTGGACAAGGTTAACTCGCTCATCATCTGC
GGCGGCATGGCCTTTACCTTTAAAAAGGTGCTCGACAACATGCCCATCGGCAACTCGCTCTTTGACGAGGCCGGC
TCCGAGATGGTGCCGCGGTTGATGGAAAAGGCCAAGGCCAAGAAAGTCAAGGTTGTGCTTCCCGTCGATTTCATC
ATCGCCGACAAGTTCGCCAAGGACGCGGCTACCGGCAAGGCCACGGACAAGGACGGCATCCCGGATGGCTGGATG
GGTCTCGACTGCGGCGAACAGTCCGTCGCCCTCTTCAAAGAGGCCATCAACGAGGCCAAGACCATCTTGTGGAAC
GGTCCCGCCGGTGTCTTTGAGTTTGACAAGTTCGCTTCGGGTACAAAGGCTACGCTTGACGCTGTCGTCGCCGCA
TGCGCGAAGGGTAACATTGTGGTCATCGGTGGGGGAGACACGGCCACAGTCGCCGCCAAGTACGGCGTCGAAGAC
AAGATAAGCCACGTGTCGACGGGTGGCGGAGCGAGTCTGGAGCTGCTGGAGGGGAAGCAATTGCCGGGCATCGAG
GCGCTGTCGACGAGGTGGATGTAA
Transcript >Ophun1|5082
ATGTCGGCCCTGCGCCGCCGTCAGACGGCGATGTCTATACTCGGGCGGATCTGTGTTATCTTCTACGTGCTCGCA
AGGTCCACCGTCTCGACCGACCGAGGCCTCGACAACGCCGCCTTCACCATCGCGGTCTGCTCTATGATTCTTGAG
GAGGCAGGGCTCCTCAGCCTCCTGGCCGACGCCTTCTGGCCGCGTCGCCCATCAGTTCTGTGGGCGGCGCGGTCG
CTCGACTTTATCGGCCTCGTCGTCTTCTCCGGCCTCAGAAAGGCCGTCATCGTCGCGTTCTTCAACTCCGTGGGC
TATGGCATGCGTTGCGCCATCCCCTATCGCCACATCTTCATGTCTCTCGCTCGGAGGCTGTCCGTCGACGACGTC
GACGTCAAGGGAAAACGGGTCCTCATCCGGGTCGACTTCAACGTGCCTCTGGACGACGACAATAAGATCACCAAC
AACCAGCGCATCGTTGGCGCCGTCCCTACCATCAAGCATGCCCTCGACCATGGTGCCAAGGCCATCATCCTCATG
TCGCATCTCGGTCGGCCAAATGGAAGCGTCAACTTGAAATACTCCCTCAAGCCCGTCGTGGCCGAGCTCGAGAAG
CTCCTCGCCAAGCCCGTCAAGCTGGCTCCGGACTGTGTCGGACCAGAAGTCGAGGCCATTGTCGCCGATGCCGAC
AACGGCGCCGTCATCTTACTCGAGAACCTGCGCTTCCATATCGAGGAAGAGGGCAGCGCCAAGGACAAGGACGGA
AACAAGCTCAAGGCGGACAAGGACAAGGTCGACGCCTTTCGCAAGGGCCTGACGGCGCTTGGAGACATCTACATC
AATGACGCTTTCGGGACGGCTCACCGTGCTCACTCGTCCATGGTGGGCGTTGACCTGCGTCAGAAGGTAGCAGGA
TTCCTCATGAAGAAAGAGCTCGATTACTTTTCCAAGGCCCTCGATAACCCGACACCCCCGTTTCTGGCCATCCTT
GGCGGCGCCAAAGTTTCGGACAAGATCCAACTCATTGACAACCTGCTGGACAAGGTTAACTCGCTCATCATCTGC
GGCGGCATGGCCTTTACCTTTAAAAAGGTGCTCGACAACATGCCCATCGGCAACTCGCTCTTTGACGAGGCCGGC
TCCGAGATGGTGCCGCGGTTGATGGAAAAGGCCAAGGCCAAGAAAGTCAAGGTTGTGCTTCCCGTCGATTTCATC
ATCGCCGACAAGTTCGCCAAGGACGCGGCTACCGGCAAGGCCACGGACAAGGACGGCATCCCGGATGGCTGGATG
GGTCTCGACTGCGGCGAACAGTCCGTCGCCCTCTTCAAAGAGGCCATCAACGAGGCCAAGACCATCTTGTGGAAC
GGTCCCGCCGGTGTCTTTGAGTTTGACAAGTTCGCTTCGGGTACAAAGGCTACGCTTGACGCTGTCGTCGCCGCA
TGCGCGAAGGGTAACATTGTGGTCATCGGTGGGGGAGACACGGCCACAGTCGCCGCCAAGTACGGCGTCGAAGAC
AAGATAAGCCACGTGTCGACGGGTGGCGGAGCGAGTCTGGAGCTGCTGGAGGGGAAGCAATTGCCGGGCATCGAG
GCGCTGTCGACGAGGTGGATGTAA
Gene >Ophun1|5082
ATGTCGGCCCTGCGCCGCCGTCAGACGGCGATGTCTATACTCGGGCGGATCTGTGTTATCTTCTACGTGCTCGCA
AGGTCCACCGTCTCGACCGACCGAGGCCTCGACAACGCCGCCTTCACCATCGCGGTCTGCTCTATGATTCTTGAG
GAGGCAGGGCTCCTCAGCCTCCTGGCCGACGCCTTCTGGCCGCGTCGCCCATCAGTTCTGTGGGCGGCGCGGTCG
CTCGACTTTATCGGCCTCGTCGTCTTCTCCGGCCTCAGAAAGGCCGTCATCGTCGCGTTCTTCAACTCCGTGGGC
TATGGCATGCGTTGGTATGTCTCGTCCTTCTCGTCTCCCCCCTTTCCGCTCTCTTAGAGCTGCTTCATGCCCCCC
ACCTGCTTACCTACCTGCCCGTGCAATTACCTCATCCGGCTACCCCGCCATTTGCCCCTCTGAGCTTTCAACCGC
TCGCTCTCCCCCTCTCTCTCTCTCTGCTAACAAAAAATTCTCCCTCCAGCGCCATCCCCTATCGCCACATCTTCA
TGTCTCTCGCTCGGAGGCTGTCCGTCGACGACGTCGACGTCAAGGGAAAACGGGTCCTCATCCGGGTGAGCCTTT
CTCCCCGCCCGTCGTCCTGCTGTGCATTCACTCATCCTGACGCAAAATAGGTCGACTTCAACGTGCCTCTGGACG
ACGACAATAAGATCACCAACAACCAGCGCATCGTTGGCGCCGTCCCTACCATCAAGCATGCCCTCGACCATGGTG
CCAAGGCCATCATCCTCATGTCGCATCTCGGTCGGCCAAATGGAAGCGTCAACTTGAAATACTCCCTCAAGCCCG
TCGTGGCCGAGCTCGAGAAGCTCCTCGCCAAGCCCGTCAAGCTGGCTCCGGACTGTGTCGGACCAGAAGTCGAGG
CCATTGTCGCCGATGCCGACAACGGCGCCGTCATCTTACTCGAGAACCTGCGCTTCCATATCGAGGAAGAGGGCA
GCGCCAAGGACAAGGACGGAAACAAGCTCAAGGCGGACAAGGACAAGGTCGACGCCTTTCGCAAGGGCCTGACGG
CGCTTGGAGACATCTACATCAGTCTGTCTACATCTCTTGCTCCCTTGACGACGTTGCTTGCTAACGGGCTTTAGA
TGACGCTTTCGGGACGGCTCACCGTGCTCACTCGTCCATGGTGGGCGTTGACCTGCGTCAGAAGGTAGCAGGATT
CCTCATGAAGAAAGAGCTCGATTACTTTTCCAAGGCCCTCGATAACCCGACACCCCCGTTTCTGGCCATCCTTGG
CGGCGCCAAAGTTTCGGACAAGATCCAACTCATTGACAACCTGCTGGACAAGGTTAACTCGCTCATCATCTGCGG
CGGCATGGCCTTTACCTTTAAAAAGGTGCTCGACAACATGCCCATCGGCAACTCGCTCTTTGACGAGGCCGGCTC
CGAGATGGTGCCGCGGTTGATGGAAAAGGCCAAGGCCAAGAAAGTCAAGGTTGTGCTTCCCGTCGATTTCATCAT
CGCCGACAAGTTCGCCAAGGACGCGGCTACCGGCAAGGCCACGGACAAGGACGGCATCCCGGATGGCTGGATGGG
TCTCGACTGCGGCGAACAGTCCGTCGCCCTCTTCAAAGAGGCCATCAACGAGGCCAAGACCATCTTGTGGAACGG
TCCCGCCGGTGTCTTTGAGTTTGACAAGTTCGCTTCGGGTACAAAGGCTACGCTTGACGCTGTCGTCGCCGCATG
CGCGAAGGGTAACATTGTGGTCATCGGTGGGGGAGACACGGCCACAGTCGCCGCCAAGTACGGCGTCGAAGACAA
GATAAGCCACGTGTCGACGGGTGGCGGAGCGAGTCTGGAGCTGCTGGAGGGGAAGCAATTGCCGGGCATCGAGGC
GCTGTCGACGAGGTGGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail