Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|508
Gene name
LocationContig_115:11712..13006
Strand+
Gene length (bp)1294
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 63 232 8.0E-14
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 70 206 3.0E-08
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 26 236 6.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 26 236 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 52 74 22
3 89 111 22
4 113 135 22
5 145 162 17
6 175 197 22
7 232 254 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|508
MGLATDVQRSPEPGDDNFKTEDNAALNTETAAITGIPFVVLMASLVLSTWLVALNATFIGTSGTTFIALYWMPVS
FQAIKQASPFQSGVWILPMSVSQLLASIVCGALVQWTGYYLPEAVFGNLSMAVGAGLFSTMSPTTTTAQWIGYQI
LVGIARGFTVTAMQANSPKQDASEAIGNVMFFQWFGGAILTCAAKTVFASSTSSSLADAAPSIDPSTIIHSGTTK
LKAIVPPIMQYLQLATACCAVVTGFGMGWKSLKSFQH*
Coding >Ophun1|508
ATGGGCCTCGCAACAGACGTCCAGAGAAGCCCGGAACCAGGAGACGACAACTTCAAGACGGAGGACAATGCCGCG
CTCAATACCGAGACTGCTGCCATCACGGGCATCCCCTTTGTCGTCCTGATGGCATCTCTCGTCCTCAGCACTTGG
CTCGTTGCCCTCAACGCCACCTTCATCGGAACTAGCGGCACCACCTTCATTGCCCTCTACTGGATGCCCGTCTCG
TTCCAGGCCATCAAGCAGGCCAGCCCCTTTCAGAGCGGCGTCTGGATCCTCCCAATGTCTGTCTCGCAGCTGCTG
GCCTCGATAGTGTGCGGAGCTCTGGTTCAGTGGACGGGATACTATCTCCCCGAAGCCGTCTTCGGGAACCTGTCC
ATGGCAGTTGGAGCTGGGCTCTTCAGCACCATGTCGCCGACAACCACGACGGCTCAGTGGATCGGCTACCAGATT
CTCGTAGGGATAGCTCGAGGCTTCACGGTGACGGCCATGCAGGCCAACAGCCCCAAGCAAGACGCCTCAGAAGCC
ATAGGCAACGTCATGTTCTTCCAGTGGTTCGGCGGTGCCATCCTGACCTGTGCGGCCAAGACGGTCTTTGCCTCT
TCCACCAGCTCGTCTCTGGCCGACGCCGCGCCCAGCATCGATCCCTCGACCATAATACACAGCGGAACCACGAAG
CTCAAGGCCATAGTTCCGCCCATTATGCAGTATCTCCAGTTGGCGACGGCCTGCTGCGCCGTCGTCACGGGCTTC
GGCATGGGCTGGAAGAGTCTCAAGAGCTTCCAGCATTAG
Transcript >Ophun1|508
ATGGGCCTCGCAACAGACGTCCAGAGAAGCCCGGAACCAGGAGACGACAACTTCAAGACGGAGGACAATGCCGCG
CTCAATACCGAGACTGCTGCCATCACGGGCATCCCCTTTGTCGTCCTGATGGCATCTCTCGTCCTCAGCACTTGG
CTCGTTGCCCTCAACGCCACCTTCATCGGAACTAGCGGCACCACCTTCATTGCCCTCTACTGGATGCCCGTCTCG
TTCCAGGCCATCAAGCAGGCCAGCCCCTTTCAGAGCGGCGTCTGGATCCTCCCAATGTCTGTCTCGCAGCTGCTG
GCCTCGATAGTGTGCGGAGCTCTGGTTCAGTGGACGGGATACTATCTCCCCGAAGCCGTCTTCGGGAACCTGTCC
ATGGCAGTTGGAGCTGGGCTCTTCAGCACCATGTCGCCGACAACCACGACGGCTCAGTGGATCGGCTACCAGATT
CTCGTAGGGATAGCTCGAGGCTTCACGGTGACGGCCATGCAGGCCAACAGCCCCAAGCAAGACGCCTCAGAAGCC
ATAGGCAACGTCATGTTCTTCCAGTGGTTCGGCGGTGCCATCCTGACCTGTGCGGCCAAGACGGTCTTTGCCTCT
TCCACCAGCTCGTCTCTGGCCGACGCCGCGCCCAGCATCGATCCCTCGACCATAATACACAGCGGAACCACGAAG
CTCAAGGCCATAGTTCCGCCCATTATGCAGTATCTCCAGTTGGCGACGGCCTGCTGCGCCGTCGTCACGGGCTTC
GGCATGGGCTGGAAGAGTCTCAAGAGCTTCCAGCATTAG
Gene >Ophun1|508
ATGGGCCTCGCAACAGACGTCCAGAGAAGCCCGGAACCAGGAGACGACAACTTCAAGACGGAGGACAATGCCGCG
CTCAATACCGAGACTGCTGCCATCACGGGCATCCCCTTTGTCGTCCTGATGGCATCTCTCGTCCTCAGCACTTGG
CTCGTTGCCCTCAACGCCACCTTCATCGGAACTGTGAGAAAAGATCCCATCCCATGACGGCTATTGCCGCTGCTG
TGCCCATCAAGGATCGGGCGCTGCTTATTGGCATCGTCATGGGGTGCTTTGGCGTGGGTCAGGCGGTTGGCCCCC
TTTTTTGAGGGGGCTTTGACGTCGTATGTCTCCTGGAGGTGGTGTTTCTTCCTGTAAATCGTTACCGTTCGTCAT
CTTTACCCTTCTTCGGCCTCCTCTCCGGGGGGGCAGCCACCTTTCTTATCTTCGCCGCCTGGCTCTACCACAAGG
GAGACTCTGGACTCGTGAAGCTGCGGCTTCTTAGTGGCCTCACGTACGCCTCGATAAATCTGACGACCTTTTTCC
AGAGCGGCACCACCTTCATTGCCCTCTACTGGATGCCCGTCTCGTTCCAGGCCATCAAGCAGGCCAGCCCCTTTC
AGAGCGGCGTCTGGATCCTCCCAATGTCTGTCTCGCAGCTGCTGGCCTCGATAGTGTGCGGAGCTCTGGTTCAGT
GGACGGGATACTATCTCCCCGAAGCCGTCTTCGGGAACCTGTCCATGGCAGTTGGAGCTGGGCTCTTCAGCACCA
TGTCGCCGACAACCACGACGGCTCAGTGGATCGGCTACCAGATTCTCGTAGGGATAGCTCGAGGCTTCGTGCTTC
AACTGGCACGTCTTCTTCTCTTCTTCTCCCCTTTCCATGGCTGACAGACGACACAGACGGTGACGGCCATGCAGG
CCAACAGCCCCAAGCAAGACGCCTCAGAAGCCATAGGCAACGTCATGTTCTTCCAGTGGTTCGGCGGTGCCATCC
TGACCTGTGCGGCCAAGACGGTCTTTGCCTCTTCCACCAGCTCGTCTCTGGCCGACGCCGCGCCCAGCATCGATC
CCTCGACCATAATACACAGCGGAACCACGAAGCTCAAGGCCATAGTTCCGCCCAGTCAGTGGCCTGGGCTTCTGC
ACGCGTACAGCCAAGCCATAGACGCCGTCTTCGTAAGAGATCAACTCCTTGCATGACCGGTATCTGTTACTTACA
AGTTATGCAGTATCTCCAGTTGGCGACGGCCTGCTGCGCCGTCGTCACGGGCTTCGGCATGGGCTGGAAGAGTCT
CAAGAGCTTCCAGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail