Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5078
Gene name
LocationContig_488:7459..9170
Strand-
Gene length (bp)1711
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.0E-10 39 345

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9SAA9|CP511_ARATH Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 5 310 4.0E-14
sp|P93846|CP51_SORBI Obtusifoliol 14-alpha demethylase OS=Sorghum bicolor GN=CYP51 PE=1 SV=1 6 310 2.0E-13
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 1 345 9.0E-13
sp|P93596|CP51_WHEAT Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 29 310 5.0E-11
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 15 309 9.0E-08

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5078
MALTLLLIALAPLAAAIVILVQMVSSRPRLPPDAPREVRGWPLLGCLDFFRRRRDFLVWGSKLGPGRQFSFFYGP
HPIVAVSGPEARASFFNSRELSLGAGFAGLYAASPNIEHLPEGNVAGNFMSLAKRLLHRDRLEAVLPTMVSDADT
ALATSDAILEPFALMLRLVYKLTHRTLGSNDIADNQDLLEETLAVFGKLDQSSALEIMFPRLFTPSKLRKMMAGL
KLHRVFSAVVERRRVEGRKQMDAMQLLMEATNSNAQISAFIISALFAGLINSTFNAAWILVYLSTNPDWYARIRS
EVDASIARHGLPDETPPKTLTRLSLSDWESDFPLVEVAMRETIRLIGRGVCMRKNFAKLEIIITTVTTFAHYDFH
RCDKHGDDVSLPLPGLVRSSIGEKRPEHDVFLRCVSRGGC*
Coding >Ophun1|5078
ATGGCCCTCACCCTCCTCCTCATCGCCCTCGCCCCTCTGGCGGCCGCCATCGTCATCCTCGTCCAGATGGTATCC
TCGCGTCCGCGCCTCCCCCCCGATGCTCCTCGCGAGGTCCGCGGCTGGCCTCTTCTCGGCTGTCTCGACTTCTTC
CGTCGGAGGCGCGATTTCCTCGTCTGGGGGAGTAAGCTCGGGCCCGGTCGGCAGTTTAGCTTCTTCTACGGACCG
CATCCCATCGTCGCTGTTTCGGGCCCGGAGGCGCGGGCTTCCTTCTTCAATTCCAGGGAGTTGAGCTTGGGGGCT
GGCTTCGCCGGTCTCTACGCTGCCAGCCCCAACATCGAACACCTCCCAGAAGGCAACGTCGCAGGCAACTTCATG
TCCCTGGCCAAACGCCTCCTCCACCGCGACCGCCTGGAAGCCGTCCTCCCGACCATGGTCTCAGACGCCGACACC
GCCCTCGCAACCTCGGACGCCATCCTCGAGCCCTTTGCGCTGATGCTCCGTCTGGTGTACAAGCTGACGCACCGG
ACGCTGGGCAGCAACGACATCGCCGACAACCAAGACCTCTTGGAAGAGACGCTGGCGGTGTTTGGGAAGCTGGAT
CAGAGCTCGGCGTTGGAAATCATGTTTCCTCGCTTGTTTACGCCCAGCAAGTTGCGCAAGATGATGGCTGGGTTG
AAGCTGCATCGTGTGTTTTCGGCAGTGGTGGAGAGGAGGAGGGTTGAAGGGAGGAAGCAGATGGATGCCATGCAG
CTTCTCATGGAAGCAACCAACAGCAACGCGCAAATCTCAGCCTTCATCATCAGCGCCCTCTTCGCAGGCCTCATC
AACAGCACCTTCAACGCCGCCTGGATCCTCGTCTACCTCAGCACCAACCCGGACTGGTACGCCCGCATCCGATCC
GAAGTCGACGCCTCCATCGCCAGACACGGCCTCCCAGACGAAACGCCGCCCAAGACGTTGACGCGTCTGTCCCTC
TCCGACTGGGAGTCTGACTTTCCCCTCGTCGAGGTGGCCATGCGCGAGACGATCCGGCTGATTGGACGGGGCGTG
TGTATGCGCAAGAATTTCGCCAAGCTGGAAATCATCATCACCACAGTCACCACCTTTGCCCACTACGACTTCCAC
CGCTGCGATAAGCACGGCGACGACGTCAGTCTTCCGCTTCCGGGGCTGGTCCGGAGTAGTATCGGTGAGAAGCGG
CCGGAGCATGACGTGTTTCTGCGCTGTGTGTCGCGGGGGGGTTGCTGA
Transcript >Ophun1|5078
ATGGCCCTCACCCTCCTCCTCATCGCCCTCGCCCCTCTGGCGGCCGCCATCGTCATCCTCGTCCAGATGGTATCC
TCGCGTCCGCGCCTCCCCCCCGATGCTCCTCGCGAGGTCCGCGGCTGGCCTCTTCTCGGCTGTCTCGACTTCTTC
CGTCGGAGGCGCGATTTCCTCGTCTGGGGGAGTAAGCTCGGGCCCGGTCGGCAGTTTAGCTTCTTCTACGGACCG
CATCCCATCGTCGCTGTTTCGGGCCCGGAGGCGCGGGCTTCCTTCTTCAATTCCAGGGAGTTGAGCTTGGGGGCT
GGCTTCGCCGGTCTCTACGCTGCCAGCCCCAACATCGAACACCTCCCAGAAGGCAACGTCGCAGGCAACTTCATG
TCCCTGGCCAAACGCCTCCTCCACCGCGACCGCCTGGAAGCCGTCCTCCCGACCATGGTCTCAGACGCCGACACC
GCCCTCGCAACCTCGGACGCCATCCTCGAGCCCTTTGCGCTGATGCTCCGTCTGGTGTACAAGCTGACGCACCGG
ACGCTGGGCAGCAACGACATCGCCGACAACCAAGACCTCTTGGAAGAGACGCTGGCGGTGTTTGGGAAGCTGGAT
CAGAGCTCGGCGTTGGAAATCATGTTTCCTCGCTTGTTTACGCCCAGCAAGTTGCGCAAGATGATGGCTGGGTTG
AAGCTGCATCGTGTGTTTTCGGCAGTGGTGGAGAGGAGGAGGGTTGAAGGGAGGAAGCAGATGGATGCCATGCAG
CTTCTCATGGAAGCAACCAACAGCAACGCGCAAATCTCAGCCTTCATCATCAGCGCCCTCTTCGCAGGCCTCATC
AACAGCACCTTCAACGCCGCCTGGATCCTCGTCTACCTCAGCACCAACCCGGACTGGTACGCCCGCATCCGATCC
GAAGTCGACGCCTCCATCGCCAGACACGGCCTCCCAGACGAAACGCCGCCCAAGACGTTGACGCGTCTGTCCCTC
TCCGACTGGGAGTCTGACTTTCCCCTCGTCGAGGTGGCCATGCGCGAGACGATCCGGCTGATTGGACGGGGCGTG
TGTATGCGCAAGAATTTCGCCAAGCTGGAAATCATCATCACCACAGTCACCACCTTTGCCCACTACGACTTCCAC
CGCTGCGATAAGCACGGCGACGACGTCAGTCTTCCGCTTCCGGGGCTGGTCCGGAGTAGTATCGGTGAGAAGCGG
CCGGAGCATGACGTGTTTCTGCGCTGTGTGTCGCGGGGGGGTTGCTGA
Gene >Ophun1|5078
ATGGCCCTCACCCTCCTCCTCATCGCCCTCGCCCCTCTGGCGGCCGCCATCGTCATCCTCGTCCAGATGGTATCC
TCGCGTCCGCGCCTCCCCCCCGATGCTCCTCGCGAGGTCCGCGGCTGGCCTCTTCTCGGCTGTCTCGACTTCTTC
CGTCGGAGGCGCGATTTCCTCGTCTGGGGGAGTAAGCTCGGGCCCGGTCGGCAGTTTAGCTTCTTCTACGGACCG
CATCCCATCGTCGCTGTTTCGGGCCCGGAGGCGCGGGCTTCCTTCTTCAATTCCAGGGAGTTGAGCTTGGGGGCT
GGGTGAGCCTTTTTTCTTGTCGTGTTTTACAGAACTACAAGTAACGATCCAGCTCAGCTTCGCCGGTCTCTACGC
TGCCAGCCCCAACATCGAACACCTCCCAGAAGGCAACGTCGCAGGCAACTTCATGTCCCTGGCCAAACGCCTCCT
CCACCGCGACCGCCTGGAAGCCGTCCTCCCGACCATGGTCTCAGACGCCGACACCGCCCTCGCAACCTCGGACGC
CATCCTCGAGCCCTTTGCGCTGATGCTCCGTCTGGTGTACAAGCTGACGCACCGGACGCTGGGCAGCAACGACAT
CGCCGACAACCAAGACCTCTTGGAAGAGACGCTGGCGGTGTTTGGGAAGCTGGATCAGAGCTCGGCGTTGGAAAT
CATGTTTCCTCGCTTGTTTACGCCCAGCAAGTTGCGCAAGATGATGGCTGGGTTGAAGCTGCATCGTGTGTTTTC
GGCAGTGGTGGAGAGGAGGAGGGTTGAAGGGAGGAAGCAGATGGATGCCATGCAGCTTCTCATGGAAGCAACCAA
CAGCAACGCGCAAATCTCAGCCGTTCGTTCTCTCTATAACCCCCGTCCCCGTCTGATACGGAAAGGGAGGTTAAC
AACAGCGCAGTTCATCATCAGCGCCCTCTTCGCAGGCCTCATCAACAGCACCTTCAACGCCGCCTGGATCCTCGT
CTACCTCAGCACCAACCCGGACTGGTACGCCCGCATCCGATCCGAAGTCGACGCCTCCATCGCCAGACACGGCCT
CCCAGACGAAACGCCGCCCAAGACGTTGACGCGTCTGTCCCTCTCCGACTGGGAGTCTGACTTTCCCCTCGTCGA
GGTGGCCATGCGCGAGACGATCCGGCTGATTGGACGGGGCGTGTGTATGCGCAAGAATGTCAGTGGCAGTGATGT
CGAGATTGGCAGCTCCGGGTGTGTTATTCCCAGTGGGGCGTATGCTGTCTGTGGGCTGGAGGATGCGCATATGGA
TGAGGGGCTTTATCCTGATGCTGATCGGTGGGATCCTGATCGGTATGCTTGCGGGAGGGAGGCGGAGAAGCAGGG
GCCGCATGATTACCTGGGATGGGGGAGCGGACTGCATCCGTGCTGTGAGTGTTGAGGAGTGAAGTCGAGCTGAGA
GAGAAGATATGCTGACGGGAAACAAACAGTAGGGATGAGGGTATATCCAGCCATCCCCTGATGTTTGTGGTTTCT
ATTATACATCTGCTAACATCGAGGTTAGTTCGCCAAGCTGGAAATCATCATCACCACAGTCACCACCTTTGCCCA
CTACGACTTCCACCGCTGCGATAAGCACGGCGACGACGTCAGTCTTCCGCTTCCGGGGCTGGTCCGGAGTAGTAT
CGGTGAGAAGCGGCCGGAGCATGACGTGTTTCTGCGCTGTGTGTCGCGGGGGGGTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail