Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5065
Gene name
LocationContig_486:8584..9307
Strand-
Gene length (bp)723
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 6.7E-07 102 126

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09776|SNU23_SCHPO U4/U6.U5 small nuclear ribonucleoprotein component snu23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snu23 PE=3 SV=4 64 236 2.0E-20
sp|Q9CPW7|ZMAT2_MOUSE Zinc finger matrin-type protein 2 OS=Mus musculus GN=Zmat2 PE=2 SV=1 9 238 6.0E-11
sp|Q96NC0|ZMAT2_HUMAN Zinc finger matrin-type protein 2 OS=Homo sapiens GN=ZMAT2 PE=1 SV=1 9 238 6.0E-11
sp|P34670|YO14_CAEEL Putative zinc finger protein ZK686.4 OS=Caenorhabditis elegans GN=ZK686.4 PE=4 SV=1 11 238 3.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4772
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6920
Ophiocordyceps australis map64 (Brazil) OphauB2|3919
Ophiocordyceps camponoti-floridani Ophcf2|03929
Ophiocordyceps camponoti-rufipedis Ophun1|5065 (this protein)
Ophiocordyceps kimflemingae Ophio5|5265
Ophiocordyceps subramaniannii Hirsu2|10093

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5065
MADPHKRSAYGAPADDTDFRKTYDLDEYAAKAREREAREKVEARARYEARLAGKKHPTMTPTGNETFATARRTTL
DVASQVGKKQLVPAGAGVGRRGRSAGFYCEACDLTFKDNKQLVEHHNSTQHLLRTGQKPHVQRATAAEVRARIDM
LVARQEELRRDDATNLTERLRLRGEEQRRADEEKRRKRREEVEARRKQREEEKRAKADYGDDVRIEGEHDEDDMM
AQLGIVGFGGSKKKG*
Coding >Ophun1|5065
ATGGCAGACCCTCACAAGCGCAGCGCATACGGCGCCCCGGCAGACGACACCGACTTCCGCAAAACGTACGATCTG
GACGAGTATGCCGCCAAAGCCCGGGAACGCGAGGCACGAGAAAAAGTCGAGGCCAGGGCGCGATACGAGGCACGA
CTGGCGGGCAAGAAGCATCCCACCATGACACCAACGGGCAACGAGACGTTTGCGACGGCCCGACGCACGACGCTC
GACGTGGCCTCGCAAGTGGGCAAGAAGCAACTGGTACCAGCCGGAGCGGGCGTCGGGCGTCGCGGTCGAAGCGCG
GGATTCTACTGCGAGGCCTGCGACCTCACCTTCAAAGACAACAAACAGCTTGTCGAACATCACAACTCGACGCAA
CATCTGCTGAGGACGGGGCAGAAGCCGCACGTGCAGCGCGCCACGGCGGCCGAGGTCCGCGCCCGCATCGACATG
CTGGTTGCGCGTCAAGAGGAGCTTCGGCGTGACGACGCTACAAACTTGACTGAACGGCTGCGGCTGCGCGGCGAG
GAGCAGAGGCGTGCGGATGAGGAGAAGAGGAGGAAGCGGCGAGAAGAGGTCGAGGCCAGGAGGAAGCAGCGCGAG
GAGGAGAAGCGGGCCAAGGCTGACTATGGGGACGATGTACGGATCGAGGGCGAGCATGACGAGGATGATATGATG
GCGCAATTGGGAATCGTAGGCTTTGGCGGCTCCAAGAAGAAGGGCTGA
Transcript >Ophun1|5065
ATGGCAGACCCTCACAAGCGCAGCGCATACGGCGCCCCGGCAGACGACACCGACTTCCGCAAAACGTACGATCTG
GACGAGTATGCCGCCAAAGCCCGGGAACGCGAGGCACGAGAAAAAGTCGAGGCCAGGGCGCGATACGAGGCACGA
CTGGCGGGCAAGAAGCATCCCACCATGACACCAACGGGCAACGAGACGTTTGCGACGGCCCGACGCACGACGCTC
GACGTGGCCTCGCAAGTGGGCAAGAAGCAACTGGTACCAGCCGGAGCGGGCGTCGGGCGTCGCGGTCGAAGCGCG
GGATTCTACTGCGAGGCCTGCGACCTCACCTTCAAAGACAACAAACAGCTTGTCGAACATCACAACTCGACGCAA
CATCTGCTGAGGACGGGGCAGAAGCCGCACGTGCAGCGCGCCACGGCGGCCGAGGTCCGCGCCCGCATCGACATG
CTGGTTGCGCGTCAAGAGGAGCTTCGGCGTGACGACGCTACAAACTTGACTGAACGGCTGCGGCTGCGCGGCGAG
GAGCAGAGGCGTGCGGATGAGGAGAAGAGGAGGAAGCGGCGAGAAGAGGTCGAGGCCAGGAGGAAGCAGCGCGAG
GAGGAGAAGCGGGCCAAGGCTGACTATGGGGACGATGTACGGATCGAGGGCGAGCATGACGAGGATGATATGATG
GCGCAATTGGGAATCGTAGGCTTTGGCGGCTCCAAGAAGAAGGGCTGA
Gene >Ophun1|5065
ATGGCAGACCCTCACAAGCGCAGCGCATACGGCGCCCCGGCAGACGACACCGACTTCCGCAAAACGTACGATCTG
GACGAGTATGCCGCCAAAGCCCGGGAACGCGAGGCACGAGAAAAAGTCGAGGCCAGGGCGCGATACGAGGCACGA
CTGGCGGGCAAGAAGCATCCCACCATGACACCAACGGGCAACGAGACGTTTGCGACGGCCCGACGCACGACGCTC
GACGTGGCCTCGCAAGTGGGCAAGAAGCAACTGGTACCAGCCGGAGCGGGCGTCGGGCGTCGCGGTCGAAGCGCG
GGATTCTACTGCGAGGCCTGCGACCTCACCTTCAAAGACAACAAACAGCTTGTCGAACATCACAACTCGACGCAA
CATCTGCTGAGGACGGGGCAGAAGCCGCACGTGCAGCGCGCCACGGCGGCCGAGGTCCGCGCCCGCATCGACATG
CTGGTTGCGCGTCAAGAGGAGCTTCGGCGTGACGACGCTACAAACTTGACTGAACGGCTGCGGCTGCGCGGCGAG
GAGCAGAGGCGTGCGGATGAGGAGAAGAGGAGGAAGCGGCGAGAAGAGGTCGAGGCCAGGAGGAAGCAGCGCGAG
GAGGAGAAGCGGGCCAAGGCTGACTATGGGGACGATGTACGGATCGAGGGCGAGCATGACGAGGATGATATGATG
GCGCAATTGGGAATCGTAGGCTTTGGCGGCTCCAAGAAGAAGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail