Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5055
Gene name
LocationContig_485:3203..4452
Strand+
Gene length (bp)1249
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 5.7E-24 43 259
PF08449 UAA UAA transporter family 1.4E-07 288 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5W2|HUT1_EMENI UDP-galactose transporter homolog 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hut1 PE=3 SV=1 40 337 3.0E-103
sp|Q4WJM7|HUT1_ASPFU UDP-galactose transporter homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hut1 PE=3 SV=1 1 342 2.0E-94
sp|Q6C4X5|HUT1_YARLI UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 5 331 6.0E-74
sp|Q5ADN8|HUT1_CANAL UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 43 338 3.0E-57
sp|Q6BMV3|HUT1_DEBHA UDP-galactose transporter homolog 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HUT1 PE=3 SV=2 43 333 1.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5W2|HUT1_EMENI UDP-galactose transporter homolog 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hut1 PE=3 SV=1 40 337 3.0E-103
sp|Q4WJM7|HUT1_ASPFU UDP-galactose transporter homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hut1 PE=3 SV=1 1 342 2.0E-94
sp|Q6C4X5|HUT1_YARLI UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 5 331 6.0E-74
sp|Q5ADN8|HUT1_CANAL UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 43 338 3.0E-57
sp|Q6BMV3|HUT1_DEBHA UDP-galactose transporter homolog 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HUT1 PE=3 SV=2 43 333 1.0E-56
sp|P0CP32|HUT1_CRYNJ UDP-galactose transporter homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HUT1-A PE=3 SV=1 42 341 3.0E-48
sp|P0CP33|HUT1_CRYNB UDP-galactose transporter homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HUT1-A PE=3 SV=1 42 341 3.0E-48
sp|Q4P9R2|HUT1_USTMA UDP-galactose transporter homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HUT1 PE=3 SV=2 40 350 1.0E-45
sp|Q8WZJ9|HUT1_SCHPO UDP-galactose transporter homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hut1 PE=3 SV=1 42 350 3.0E-45
sp|Q755H7|HUT1_ASHGO UDP-galactose transporter homolog 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUT1 PE=3 SV=2 42 349 1.0E-44
sp|Q6FSF8|HUT1_CANGA UDP-galactose transporter homolog 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HUT1 PE=3 SV=1 38 349 1.0E-43
sp|Q12520|HUT1_YEAST UDP-galactose transporter homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUT1 PE=1 SV=1 43 341 3.0E-40
sp|Q6CR04|HUT1_KLULA UDP-galactose transporter homolog 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HUT1 PE=3 SV=1 44 348 3.0E-39
sp|Q54I86|S35B1_DICDI Solute carrier family 35 member B1 OS=Dictyostelium discoideum GN=slc35b1 PE=3 SV=2 3 338 5.0E-30
sp|P97858|S35B1_MOUSE Solute carrier family 35 member B1 OS=Mus musculus GN=Slc35b1 PE=1 SV=1 42 338 8.0E-21
sp|Q55DM5|S35B2_DICDI Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Dictyostelium discoideum GN=slc35b2 PE=3 SV=1 18 338 8.0E-21
sp|Q6NMB6|UTR5B_ARATH UDP-galactose/UDP-glucose transporter 5B OS=Arabidopsis thaliana GN=At5g59740 PE=2 SV=1 37 338 9.0E-20
sp|O64503|UTR1_ARATH UDP-galactose/UDP-glucose transporter 1 OS=Arabidopsis thaliana GN=UTR1 PE=1 SV=1 43 349 3.0E-19
sp|Q9VEI3|S35B2_DROME Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Drosophila melanogaster GN=sll PE=1 SV=1 34 349 8.0E-19
sp|Q66HX0|S35B1_DANRE Solute carrier family 35 member B1 OS=Danio rerio GN=slc35b1 PE=2 SV=1 32 338 1.0E-18
sp|Q8AWB6|S35B1_CHICK Solute carrier family 35 member B1 OS=Gallus gallus GN=SLC35B1 PE=2 SV=1 28 331 3.0E-18
sp|Q6V7K3|S35B1_RAT Solute carrier family 35 member B1 OS=Rattus norvegicus GN=Slc35b1 PE=2 SV=1 42 338 6.0E-18
sp|Q9M9S6|UTR3_ARATH UDP-galactose/UDP-glucose transporter 3 OS=Arabidopsis thaliana GN=UTR3 PE=1 SV=1 43 347 1.0E-17
sp|Q6GQ70|S35B1_XENLA Solute carrier family 35 member B1 OS=Xenopus laevis GN=slc35b1 PE=2 SV=1 42 338 4.0E-17
sp|Q8MII5|S35B1_BOVIN Solute carrier family 35 member B1 OS=Bos taurus GN=SLC35B1 PE=2 SV=2 42 338 5.0E-17
sp|Q8AXS6|S35B1_XENTR Solute carrier family 35 member B1 OS=Xenopus tropicalis GN=slc35b1 PE=2 SV=2 42 338 6.0E-17
sp|P78383|S35B1_HUMAN Solute carrier family 35 member B1 OS=Homo sapiens GN=SLC35B1 PE=1 SV=1 42 338 3.0E-16
sp|Q6NM25|UTR5_ARATH UDP-galactose/UDP-glucose transporter 5 OS=Arabidopsis thaliana GN=UTR5 PE=2 SV=1 45 338 1.0E-15
sp|Q9VDD7|S35B1_DROME Solute carrier family 35 member B1 homolog OS=Drosophila melanogaster GN=meigo PE=2 SV=1 49 339 3.0E-15
sp|Q91ZN5|S35B2_MOUSE Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus GN=Slc35b2 PE=1 SV=1 36 273 1.0E-13
sp|Q8TB61|S35B2_HUMAN Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Homo sapiens GN=SLC35B2 PE=1 SV=1 36 310 1.0E-12
sp|Q5R9A1|S35B2_PONAB Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Pongo abelii GN=SLC35B2 PE=2 SV=2 36 310 2.0E-12
sp|Q922Q5|S35B3_MOUSE Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Mus musculus GN=Slc35b3 PE=2 SV=1 38 194 3.0E-06
sp|Q7Q5D4|S35B3_ANOGA Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Anopheles gambiae GN=Papst2 PE=3 SV=4 5 325 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 76 98 22
3 118 140 22
4 144 166 22
5 173 195 22
6 210 232 22
7 253 275 22
8 312 334 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5055
MARTKQQQQQKQQQQQQQQQKQTVANHNHGPRPRPPRQQLYQLAMAVAGIYGSFLTWAYLQEKLTTTGYGPTKER
WRYPVVLNTLQSVLAAVVGACYLVATRPRGGRVPAVITRREMVLPLVVVAVTSSLASPFGYASLGHIDYVTFLLA
KSCKLLPVMGLHVVLFGRRYPRYKYFVVAAVTAGVAVFTVYSSSGKKKGRTSAGDGGGGGSMTWGLFLLCVNLLL
DGLTNTTQDHIFRAYAPYTGPQMMCANNVLSSLVTGAYLLAGPFLAAASWPRGLGLDVEAGVLLVTVTVTRKMFT
MMLSVVAFGHRLGRMQWLGVGLVFGGIGLEALIARRDKLDKETDGEKKKS*
Coding >Ophun1|5055
ATGGCGCGGACCAAGCAGCAGCAGCAGCAGAAGCAGCAGCAGCAGCAACAACAACAACAAAAGCAAACAGTCGCC
AATCACAACCATGGGCCTCGTCCTCGTCCTCCTCGCCAGCAGCTGTACCAGCTGGCCATGGCGGTGGCTGGCATC
TACGGCTCGTTCCTGACGTGGGCGTACCTCCAGGAGAAGCTGACGACGACGGGCTACGGACCGACCAAGGAGCGA
TGGCGATACCCCGTGGTTCTGAACACGCTGCAGTCGGTGCTGGCGGCGGTTGTCGGGGCGTGCTACCTTGTCGCG
ACTCGGCCGCGAGGCGGACGGGTTCCGGCGGTGATAACGAGGCGGGAGATGGTGTTGCCGCTGGTGGTTGTTGCG
GTGACGAGCAGCCTGGCCAGCCCGTTTGGGTACGCGAGTCTTGGGCACATCGACTATGTTACGTTTCTGCTGGCC
AAGAGCTGTAAGCTTCTGCCGGTCATGGGGCTGCATGTTGTCTTGTTTGGGAGGCGGTATCCGCGGTACAAGTAT
TTTGTTGTTGCGGCTGTGACTGCGGGCGTTGCTGTCTTTACCGTCTACTCTTCATCCGGGAAGAAGAAGGGGAGG
ACTTCGGCTGGTGATGGTGGAGGAGGAGGATCGATGACATGGGGTCTTTTCCTCCTCTGCGTCAACCTCCTCCTC
GACGGCCTGACCAACACGACGCAGGACCACATCTTCCGCGCCTACGCTCCCTACACGGGCCCGCAGATGATGTGC
GCCAACAACGTGCTGAGCTCGCTGGTGACGGGCGCCTATCTGCTTGCCGGGCCCTTTCTGGCCGCCGCGTCTTGG
CCGCGGGGGTTGGGCCTGGATGTCGAGGCCGGGGTCCTCCTCGTCACCGTAACCGTCACGCGCAAAATGTTCACC
ATGATGCTCTCCGTCGTCGCCTTCGGCCACCGCCTCGGCCGCATGCAGTGGCTCGGCGTCGGCCTCGTCTTTGGC
GGCATTGGCCTCGAGGCTTTGATTGCTAGGAGGGACAAGTTGGATAAGGAGACGGATGGGGAGAAGAAGAAGTCT
TGA
Transcript >Ophun1|5055
ATGGCGCGGACCAAGCAGCAGCAGCAGCAGAAGCAGCAGCAGCAGCAACAACAACAACAAAAGCAAACAGTCGCC
AATCACAACCATGGGCCTCGTCCTCGTCCTCCTCGCCAGCAGCTGTACCAGCTGGCCATGGCGGTGGCTGGCATC
TACGGCTCGTTCCTGACGTGGGCGTACCTCCAGGAGAAGCTGACGACGACGGGCTACGGACCGACCAAGGAGCGA
TGGCGATACCCCGTGGTTCTGAACACGCTGCAGTCGGTGCTGGCGGCGGTTGTCGGGGCGTGCTACCTTGTCGCG
ACTCGGCCGCGAGGCGGACGGGTTCCGGCGGTGATAACGAGGCGGGAGATGGTGTTGCCGCTGGTGGTTGTTGCG
GTGACGAGCAGCCTGGCCAGCCCGTTTGGGTACGCGAGTCTTGGGCACATCGACTATGTTACGTTTCTGCTGGCC
AAGAGCTGTAAGCTTCTGCCGGTCATGGGGCTGCATGTTGTCTTGTTTGGGAGGCGGTATCCGCGGTACAAGTAT
TTTGTTGTTGCGGCTGTGACTGCGGGCGTTGCTGTCTTTACCGTCTACTCTTCATCCGGGAAGAAGAAGGGGAGG
ACTTCGGCTGGTGATGGTGGAGGAGGAGGATCGATGACATGGGGTCTTTTCCTCCTCTGCGTCAACCTCCTCCTC
GACGGCCTGACCAACACGACGCAGGACCACATCTTCCGCGCCTACGCTCCCTACACGGGCCCGCAGATGATGTGC
GCCAACAACGTGCTGAGCTCGCTGGTGACGGGCGCCTATCTGCTTGCCGGGCCCTTTCTGGCCGCCGCGTCTTGG
CCGCGGGGGTTGGGCCTGGATGTCGAGGCCGGGGTCCTCCTCGTCACCGTAACCGTCACGCGCAAAATGTTCACC
ATGATGCTCTCCGTCGTCGCCTTCGGCCACCGCCTCGGCCGCATGCAGTGGCTCGGCGTCGGCCTCGTCTTTGGC
GGCATTGGCCTCGAGGCTTTGATTGCTAGGAGGGACAAGTTGGATAAGGAGACGGATGGGGAGAAGAAGAAGTCT
TGA
Gene >Ophun1|5055
ATGGCGCGGACCAAGCAGCAGCAGCAGCAGAAGCAGCAGCAGCAGCAACAACAACAACAAAAGCAAACAGTCGCC
AATCACAACCATGGGCCTCGTCCTCGTCCTCCTCGCCAGCAGCTGTACCAGCTGGCCATGGCGGTGGCTGGCATC
TACGGCTCGTTCCTGACGTGGGCGTACCTCCAGGAGAAGCTGACGACGACGGGCTACGGACCGACCAAGGAGCGA
TGGCGATACCCCGTGGTTCTGAACACGCTGCAGTCGGTGCTGGCGGCGGTTGTCGGGGCGTGCTACCTTGTCGCG
ACTCGGCCGCGAGGCGGACGGGTTCCGGCGGTGATAACGAGGCGGGAGATGGTGTTGCCGCTGGTGGTTGTTGCG
GTGACGAGCAGCCTGGCCAGCCCGTTTGGGTACGCGAGTCTTGGGCACATCGACTATGTTACGTTTCTGCTGGCC
AAGAGCTGTAAGCTTCTGCCGGTCATGGGGCTGCATGTTGTCTTGTTTGGGAGGCGGTATCCGCGGTACAAGTAT
TTTGTTGTTGCGGCTGTGACTGCGGGCGTTGCTGTCTTTACCGTCTACTCTTCATCCGGGAAGAAGAAGGGGAGG
ACTTCGGCTGGTGATGGTGGAGGAGGAGGATCGATGACATGGGGTCTTTTCCTCCTCTGCGTCAACCTCCTCCTC
GACGGCCTGACCAACACGACGCAGGACCACATCTTCCGCGCCTACGCTCCCTACACGGGCCCGCAGATGATGTGC
GCCAACAACGTGCTGAGCTCGCTGGTGACGGGCGCCTATCTGCTTGCCGGGCCCTTTCTGGCCGCCGCGTCTTGG
CCGCGGGGGTTGGGCCTGGATGTCGAGGCCGGGGGTGAGTTGTCGTCGGCTTTGGCCTTCGTGGCGAGGCATCCT
GCTGTTTGGGTGGATTTGCTGGGCTTTGCTCTCTGCGGCGCCGTCGGGCAAGTCTTTATCTGTACGTTGACCACC
CCCCCTTCACCCTCTTCGAAAAAACCTACTAACAAAGTGATGGGGAAAAAAAGTCTACACGCTCTCAACCTTCTC
CTCAGTCCTCCTCGTCACCGTAACCGTCACGCGCAAAATGTTCACCATGATGCTCTCCGTCGTCGCCTTCGGCCA
CCGCCTCGGCCGCATGCAGTGGCTCGGCGTCGGCCTCGTCTTTGGCGGCATTGGCCTCGAGGCTTTGATTGCTAG
GAGGGACAAGTTGGATAAGGAGACGGATGGGGAGAAGAAGAAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail