Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5052
Gene name
LocationContig_484:10840..11523
Strand-
Gene length (bp)683
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12754 Blt1 Blt1 N-terminal domain 1.9E-37 6 139
PF17183 Blt1_C Get5 carboxyl domain 2.2E-13 153 195

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3123
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|320
Ophiocordyceps australis map64 (Brazil) OphauB2|3308
Ophiocordyceps camponoti-floridani Ophcf2|06704
Ophiocordyceps camponoti-rufipedis Ophun1|5052 (this protein)
Ophiocordyceps kimflemingae Ophio5|1564
Ophiocordyceps subramaniannii Hirsu2|5473

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5052
MAEAAFAQTFLSSLDSQPMKLSPDHVEDPKRYPSRPPYILPRMPKAMSKPTELAPGQERSLTVVLKSLRNPPLNI
KLTSQPLNTSLLDIKNSVFRQTRIPMDKMKILHNKRPLTDTKVLKDVVGEADNSVELSIMVIGGAAAIPPLEDSK
PKSDGAAVMQTDAFWADLKGFLKQRLDDQATVDKATRVFRASWNQTTQTRDG*
Coding >Ophun1|5052
ATGGCCGAAGCCGCCTTCGCCCAGACCTTCCTCTCCTCTCTCGACTCGCAACCCATGAAGCTCTCCCCCGACCAT
GTCGAGGATCCAAAGAGATACCCTTCGCGACCGCCTTATATCCTCCCGCGGATGCCCAAAGCCATGAGCAAACCA
ACCGAGCTGGCCCCCGGACAAGAGCGCAGCCTGACAGTCGTCCTCAAGTCGCTACGGAACCCCCCCCTCAACATC
AAGCTCACTTCCCAACCGCTCAACACCTCCCTCCTCGATATCAAGAACAGCGTCTTCCGGCAGACGAGGATACCC
ATGGACAAGATGAAGATTCTACACAACAAGCGCCCCCTGACGGATACAAAGGTCCTGAAAGACGTAGTCGGCGAG
GCGGACAACTCTGTCGAGTTATCCATCATGGTCATAGGAGGGGCCGCCGCCATCCCGCCACTCGAAGATTCCAAG
CCCAAGTCTGATGGCGCTGCCGTAATGCAGACGGATGCGTTCTGGGCAGATCTTAAGGGCTTCCTGAAGCAGCGG
TTGGACGACCAAGCGACAGTCGACAAGGCTACTCGCGTCTTTCGTGCCTCGTGGAATCAGACCACACAGACCCGC
GACGGCTAG
Transcript >Ophun1|5052
ATGGCCGAAGCCGCCTTCGCCCAGACCTTCCTCTCCTCTCTCGACTCGCAACCCATGAAGCTCTCCCCCGACCAT
GTCGAGGATCCAAAGAGATACCCTTCGCGACCGCCTTATATCCTCCCGCGGATGCCCAAAGCCATGAGCAAACCA
ACCGAGCTGGCCCCCGGACAAGAGCGCAGCCTGACAGTCGTCCTCAAGTCGCTACGGAACCCCCCCCTCAACATC
AAGCTCACTTCCCAACCGCTCAACACCTCCCTCCTCGATATCAAGAACAGCGTCTTCCGGCAGACGAGGATACCC
ATGGACAAGATGAAGATTCTACACAACAAGCGCCCCCTGACGGATACAAAGGTCCTGAAAGACGTAGTCGGCGAG
GCGGACAACTCTGTCGAGTTATCCATCATGGTCATAGGAGGGGCCGCCGCCATCCCGCCACTCGAAGATTCCAAG
CCCAAGTCTGATGGCGCTGCCGTAATGCAGACGGATGCGTTCTGGGCAGATCTTAAGGGCTTCCTGAAGCAGCGG
TTGGACGACCAAGCGACAGTCGACAAGGCTACTCGCGTCTTTCGTGCCTCGTGGAATCAGACCACACAGACCCGC
GACGGCTAG
Gene >Ophun1|5052
ATGGCCGAAGCCGCCTTCGCCCAGACCTTCCTCTCCTCTCTCGACTCGCAACCCATGAAGCTCTCCCCCGACCAT
GTCGAGGATCCAAAGAGATACCCTTCGCGACCGCCTGTGAGTTACTACGCTCGTCCTATCTTTCTACACTATCCT
CGAGACTCAGTCTTACGCGATCCCTTCATCGGCAGTATATCCTCCCGCGGATGCCCAAAGCCATGAGCAAACCAA
CCGAGCTGGCCCCCGGACAAGAGCGCAGCCTGACAGTCGTCCTCAAGTCGCTACGGAACCCCCCCCTCAACATCA
AGCTCACTTCCCAACCGCTCAACACCTCCCTCCTCGATATCAAGAACAGCGTCTTCCGGCAGACGAGGATACCCA
TGGACAAGATGAAGATTCTACACAACAAGCGCCCCCTGACGGATACAAAGGTCCTGAAAGACGTAGTCGGCGAGG
CGGACAACTCTGTCGAGTTATCCATCATGGTCATAGGAGGGGCCGCCGCCATCCCGCCACTCGAAGATTCCAAGC
CCAAGTCTGATGGCGCTGCCGTAATGCAGACGGATGCGTTCTGGGCAGATCTTAAGGGCTTCCTGAAGCAGCGGT
TGGACGACCAAGCGACAGTCGACAAGGCTACTCGCGTCTTTCGTGCCTCGTGGAATCAGACCACACAGACCCGCG
ACGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail