Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5041
Gene name
LocationContig_482:8939..10025
Strand-
Gene length (bp)1086
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 179 201 22
2 277 296 19
3 300 322 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2292
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4432
Ophiocordyceps camponoti-floridani Ophcf2|03874
Ophiocordyceps camponoti-rufipedis Ophun1|5041 (this protein)
Ophiocordyceps kimflemingae Ophio5|1633
Ophiocordyceps subramaniannii Hirsu2|3034
Ophiocordyceps subramaniannii Hirsu2|4947

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5041
MEQSCLSPARPLIPSWTATPIANLTLSAGGLLALADLNTVANRTVVAGGSSWLDALVLAPGLHYQQAADALDEQG
AEAVAVEVDDGVERRHVVSNAALVAFLRRLWLDATERPLMLDVSRAGAGEKRLGRRLSRLVCRRPRLTSPTRSSS
SSASSSGLPLQVDRLSHILYLLSPLLTSTASTFMILLGDWWGLTFIIALMISRSLNIWTIKQRTLPITTKFLSTL
PIKPPSPLDDPDDDRPTEYAIDLGDNRTALLVGLSSDLRALTTRTRLRPQTVLGGYLEAGSKLLVYMVAALSGNL
SQAGAMVLMVLLLVSAGLLGLSNARASGLRINGCVASLRLRPALGSAVDEGESERRVETLL*
Coding >Ophun1|5041
ATGGAACAAAGCTGCCTCAGCCCTGCACGCCCCCTGATCCCCTCGTGGACCGCCACGCCCATCGCCAACCTCACC
CTCTCAGCCGGTGGCCTCCTGGCGCTGGCCGATCTCAACACCGTCGCGAATCGGACTGTCGTGGCTGGCGGATCC
TCTTGGCTTGACGCCTTGGTTCTCGCGCCTGGCTTGCATTACCAACAGGCTGCGGATGCGCTGGATGAGCAGGGA
GCCGAGGCTGTTGCTGTCGAGGTGGACGATGGCGTCGAGAGACGTCATGTGGTTAGCAATGCGGCCCTCGTTGCT
TTCCTCAGGCGTCTTTGGCTTGATGCTACCGAGAGGCCTCTTATGCTGGATGTTTCGAGAGCAGGCGCCGGGGAG
AAGAGGCTGGGTCGCAGGTTGAGCCGTCTGGTATGCCGTCGTCCGAGGCTTACATCGCCAACACGATCATCTTCA
TCGTCGGCATCCTCCTCAGGTCTCCCGCTTCAAGTCGATCGCCTCAGCCACATCCTCTACCTTCTCAGCCCGCTC
CTGACATCCACGGCGTCCACCTTTATGATCCTCCTCGGCGACTGGTGGGGACTGACCTTTATCATAGCCCTCATG
ATCTCCCGCAGCCTCAACATCTGGACCATCAAGCAGCGCACCCTCCCCATAACAACAAAGTTCCTCTCAACCCTA
CCAATCAAGCCGCCCTCCCCCCTCGACGACCCCGACGACGACCGCCCAACAGAGTACGCCATCGACCTTGGGGAC
AACCGCACCGCCCTCCTCGTCGGTCTAAGCTCCGATCTGCGCGCCCTCACCACCCGCACGCGGCTGCGACCTCAG
ACGGTCCTTGGCGGCTACCTCGAAGCTGGCTCCAAGCTGCTAGTCTACATGGTGGCCGCCCTCAGCGGCAACCTG
TCCCAAGCGGGCGCCATGGTCCTCATGGTTCTCCTGCTCGTCAGCGCTGGTCTGCTTGGTCTGAGCAACGCCCGT
GCCAGCGGCTTGCGCATCAACGGCTGCGTCGCCTCCTTGAGGCTGCGGCCTGCCCTGGGATCGGCCGTTGATGAG
GGCGAGAGCGAGCGCCGCGTCGAGACTTTGCTTTAG
Transcript >Ophun1|5041
ATGGAACAAAGCTGCCTCAGCCCTGCACGCCCCCTGATCCCCTCGTGGACCGCCACGCCCATCGCCAACCTCACC
CTCTCAGCCGGTGGCCTCCTGGCGCTGGCCGATCTCAACACCGTCGCGAATCGGACTGTCGTGGCTGGCGGATCC
TCTTGGCTTGACGCCTTGGTTCTCGCGCCTGGCTTGCATTACCAACAGGCTGCGGATGCGCTGGATGAGCAGGGA
GCCGAGGCTGTTGCTGTCGAGGTGGACGATGGCGTCGAGAGACGTCATGTGGTTAGCAATGCGGCCCTCGTTGCT
TTCCTCAGGCGTCTTTGGCTTGATGCTACCGAGAGGCCTCTTATGCTGGATGTTTCGAGAGCAGGCGCCGGGGAG
AAGAGGCTGGGTCGCAGGTTGAGCCGTCTGGTATGCCGTCGTCCGAGGCTTACATCGCCAACACGATCATCTTCA
TCGTCGGCATCCTCCTCAGGTCTCCCGCTTCAAGTCGATCGCCTCAGCCACATCCTCTACCTTCTCAGCCCGCTC
CTGACATCCACGGCGTCCACCTTTATGATCCTCCTCGGCGACTGGTGGGGACTGACCTTTATCATAGCCCTCATG
ATCTCCCGCAGCCTCAACATCTGGACCATCAAGCAGCGCACCCTCCCCATAACAACAAAGTTCCTCTCAACCCTA
CCAATCAAGCCGCCCTCCCCCCTCGACGACCCCGACGACGACCGCCCAACAGAGTACGCCATCGACCTTGGGGAC
AACCGCACCGCCCTCCTCGTCGGTCTAAGCTCCGATCTGCGCGCCCTCACCACCCGCACGCGGCTGCGACCTCAG
ACGGTCCTTGGCGGCTACCTCGAAGCTGGCTCCAAGCTGCTAGTCTACATGGTGGCCGCCCTCAGCGGCAACCTG
TCCCAAGCGGGCGCCATGGTCCTCATGGTTCTCCTGCTCGTCAGCGCTGGTCTGCTTGGTCTGAGCAACGCCCGT
GCCAGCGGCTTGCGCATCAACGGCTGCGTCGCCTCCTTGAGGCTGCGGCCTGCCCTGGGATCGGCCGTTGATGAG
GGCGAGAGCGAGCGCCGCGTCGAGACTTTGCTTTAG
Gene >Ophun1|5041
ATGGAACAAAGCTGCCTCAGCCCTGCACGCCCCCTGATCCCCTCGTGGACCGCCACGCCCATCGCCAACCTCACC
CTCTCAGCCGGTGGCCTCCTGGCGCTGGCCGATCTCAACACCGTCGCGAATCGGACTGTCGTGGCTGGCGGATCC
TCTTGGCTTGACGCCTTGGTTCTCGCGCCTGGCTTGCATTACCAACAGGCTGCGGATGCGCTGGATGAGCAGGGA
GCCGAGGCTGTTGCTGTCGAGGTGGACGATGGCGTCGAGAGACGTCATGTGGTTAGCAATGCGGCCCTCGTTGCT
TTCCTCAGGCGTCTTTGGCTTGATGCTACCGAGAGGCCTCTTATGCTGGATGTTTCGAGAGCAGGCGCCGGGGAG
AAGAGGCTGGGTCGCAGGTTGAGCCGTCTGGTATGCCGTCGTCCGAGGCTTACATCGCCAACACGATCATCTTCA
TCGTCGGCATCCTCCTCAGGTCTCCCGCTTCAAGTCGATCGCCTCAGCCACATCCTCTACCTTCTCAGCCCGCTC
CTGACATCCACGGCGTCCACCTTTATGATCCTCCTCGGCGACTGGTGGGGACTGACCTTTATCATAGCCCTCATG
ATCTCCCGCAGCCTCAACATCTGGACCATCAAGCAGCGCACCCTCCCCATAACAACAAAGTTCCTCTCAACCCTA
CCAATCAAGCCGCCCTCCCCCCTCGACGACCCCGACGACGACCGCCCAACAGAGTACGCCATCGACCTTGGGGAC
AACCGCACCGCCCTCCTCGTCGGTCTAAGCTCCGATCTGCGCGCCCTCACCACCCGCACGCGGCTGCGACCTCAG
ACGGTCCTTGGCGGCTACCTCGAAGCTGGCTCCAAGCTGCTAGTCTACATGGTGGCCGCCCTCAGCGGCAACCTG
TCCCAAGCGGGCGCCATGGTCCTCATGGTTCTCCTGCTCGTCAGCGCTGGTCTGCTTGGTCTGAGCAACGCCCGT
GCCAGCGGCTTGCGCATCAACGGCTGCGTCGCCTCCTTGAGGCTGCGGCCTGCCCTGGGATCGGCCGTTGATGAG
GGCGAGAGCGAGCGCCGCGTCGAGACTTTGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail