Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|504
Gene name
LocationContig_115:2882..5766
Strand+
Gene length (bp)2884
Transcript length (bp)2823
Coding sequence length (bp)2823
Protein length (aa) 941

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 409 812 5.0E-16
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 404 857 2.0E-12
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 404 857 2.0E-12
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 404 857 6.0E-11
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 404 587 5.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 48 70 22
3 90 112 22
4 124 146 22
5 206 228 22
6 402 424 22
7 439 461 22
8 481 503 22
9 518 540 22
10 591 613 22
11 715 737 22
12 744 766 22
13 771 793 22
14 806 828 22
15 833 855 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|504
MDGRVPNRGPVVFAVTTATLLLATAFVGARIVCRHYIVRNVSWDDRVMALAWLIALFLSFTIDLGAVTGLGKHDA
DISKRDLETLRRCEYVFSILYNPALMATKTSVLIFYLRIAKNTQVVLRYASWATLVVVNVSGLVLTFINIFQCSP
VGAAWMAGEDHQSSCIPLLTEFICAAPINIVTDLAVLALPIPVLTGMRLPSRQKTILVLTFTVGIFVAIVDVIRI
YYLQRAVSNVFMAPSSRPEARFGGEADFAWNASLSLMWSAVEVNVGMACACVPALKPLIMKLLPSMLYDPDGTWG
STESRAPGDFIPSRKRSSHAASASPVLALGSIHTDDGPPVSINDFSPAPDAAYLGSPVPDSALAVRTPTTATTGD
HGVYFGFVNLAKPKSMLRASAADSLRYCTVVSILFFLWGLSYGLLNSLNNAVAAVNHISTAKTLGLTSAYFGGGY
LFGPLLVGEWVLRRDEHNRSKRHEKDGAENVGGFKATFIVGLCIYGIGTMIFWPSAVANSYGGFMLSNFVVGFGL
SVLEVGANAFMVLCGPPEYGETRLLLAQGVQAVGSVVSGVLADKVFFKGIARDNPHDSMTLINVQWTYLGITLLC
VVLGLFFFYMPLPEVSDDELQRSASQLPVETNKRSVGGLELRTVCLALAVFAQYAYVAAQESNNIFFRSLILSAV
PESSSPVRQRRAAGGAGHLGGVTDPNRPLGFAITMADFLLVGRAIFALSRFLMAFLTFLSVGRRRMPQPRTYLAM
SVGLCLVSSMVLVVRRPSSPILLATCAAVFFLGEGPIWPLVFAIGLRGQGSRTKRAAAFITMGGAGPAFFPFIMY
GIVESGRTLQTAFVVVVALQVAMLLYPAFLGLSRDARRLVDPCSAVRRALQRQDEEEMTMDEFVVHRHRIERRRL
HKGGLLRQASRSFGARFVMAPRKLSQQADVEHSEGGSRSP*
Coding >Ophun1|504
ATGGACGGGCGCGTTCCGAATCGTGGTCCGGTCGTCTTCGCCGTCACCACTGCGACGCTTCTGCTCGCAACCGCC
TTCGTCGGCGCTCGCATTGTCTGTCGTCACTACATCGTCCGCAATGTGTCGTGGGACGACAGGGTCATGGCTTTG
GCCTGGCTCATCGCCTTGTTCCTCTCCTTCACCATCGACCTCGGTGCCGTCACGGGCCTGGGCAAGCATGACGCA
GACATATCGAAGCGTGATCTCGAAACGCTCCGTCGCTGCGAATATGTCTTTTCCATCTTATACAACCCGGCCCTC
ATGGCAACAAAGACCAGCGTCTTGATCTTCTACCTGCGCATCGCCAAGAATACCCAGGTCGTGCTGCGATACGCC
TCGTGGGCCACCCTGGTCGTCGTCAACGTCTCGGGCCTTGTCCTCACCTTTATCAACATCTTCCAGTGCAGTCCC
GTCGGCGCCGCCTGGATGGCCGGTGAAGATCACCAATCGTCGTGTATCCCGCTCCTCACAGAGTTCATCTGCGCT
GCTCCCATCAACATCGTCACCGACTTGGCCGTTCTCGCCCTGCCCATACCCGTCCTCACCGGCATGCGCCTCCCT
TCGCGGCAGAAGACGATCCTGGTGCTGACCTTTACCGTCGGCATCTTCGTCGCCATTGTTGACGTCATCCGCATC
TATTACCTTCAGCGCGCCGTCTCCAACGTCTTCATGGCGCCTTCGAGCCGTCCCGAGGCGAGATTCGGAGGCGAG
GCCGACTTTGCGTGGAACGCCTCGCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGCA
TGCGTGCCGGCCCTCAAGCCCCTGATTATGAAGCTGCTGCCTTCTATGCTGTACGATCCAGACGGGACCTGGGGC
TCTACCGAGTCCAGGGCTCCTGGCGACTTTATCCCCTCTCGCAAACGGTCGAGCCACGCTGCGTCGGCGTCTCCC
GTACTGGCACTCGGGTCTATCCATACCGATGACGGGCCACCGGTCAGCATCAACGACTTTTCCCCGGCGCCGGAC
GCGGCCTACCTCGGCTCCCCGGTCCCGGACTCGGCGCTCGCCGTGCGCACCCCGACGACGGCGACGACGGGCGAT
CACGGCGTGTACTTTGGCTTCGTTAACCTGGCCAAGCCCAAGAGCATGCTGAGGGCCAGCGCTGCGGACTCGCTG
CGATACTGCACCGTCGTCTCCATCCTCTTCTTCCTCTGGGGTCTCTCGTACGGTCTCCTCAACAGCCTTAATAAT
GCCGTCGCCGCCGTCAACCACATCTCGACGGCAAAGACGCTGGGCTTGACCAGCGCCTACTTCGGCGGCGGTTAC
TTGTTCGGCCCTCTGCTGGTGGGTGAATGGGTCCTGCGCCGGGATGAGCACAACCGTTCCAAGCGGCACGAAAAG
GACGGCGCTGAGAACGTGGGCGGCTTCAAGGCGACTTTCATCGTCGGCCTGTGCATCTACGGCATCGGGACCATG
ATCTTCTGGCCCTCGGCCGTGGCCAACTCGTACGGCGGCTTCATGCTCAGCAACTTCGTCGTCGGCTTCGGCCTC
TCGGTGCTCGAGGTGGGCGCCAACGCCTTCATGGTGCTCTGCGGTCCGCCCGAGTACGGCGAGACGCGGCTGCTA
CTGGCTCAAGGCGTCCAAGCCGTCGGCAGCGTCGTGAGCGGCGTTCTGGCGGACAAGGTCTTCTTCAAGGGCATC
GCTCGCGACAACCCCCACGACAGCATGACGCTCATCAACGTCCAGTGGACGTATCTCGGCATCACCCTTCTGTGT
GTCGTCCTCGGCCTCTTCTTCTTCTACATGCCGCTGCCCGAGGTCAGCGACGACGAGCTGCAACGGTCGGCGAGC
CAGTTACCCGTCGAGACGAACAAGAGGAGCGTCGGCGGCCTCGAGCTGCGGACCGTCTGCCTGGCGCTGGCCGTC
TTCGCCCAGTACGCCTACGTGGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGCCTCATTCTCTCGGCCGTG
CCCGAATCGTCGTCTCCGGTGAGGCAGCGCAGGGCGGCGGGCGGCGCGGGACACCTGGGGGGCGTTACCGACCCG
AACAGGCCGTTGGGGTTCGCCATCACCATGGCCGACTTTCTCCTGGTCGGACGCGCCATCTTTGCCCTGTCGCGC
TTCCTGATGGCCTTTCTCACCTTCTTGTCCGTCGGCCGTCGTCGGATGCCGCAACCGCGGACCTACCTGGCCATG
AGCGTGGGCCTATGCCTCGTGTCGTCGATGGTGCTCGTAGTGCGCCGGCCGTCGAGCCCGATACTACTCGCCACT
TGCGCTGCCGTCTTCTTCTTGGGCGAGGGTCCGATATGGCCCCTCGTCTTCGCCATCGGCCTCCGGGGTCAAGGC
TCGAGGACGAAGCGTGCCGCGGCCTTTATCACCATGGGTGGCGCCGGGCCGGCCTTTTTCCCATTCATCATGTAC
GGCATCGTCGAGAGCGGCAGAACATTGCAGACAGCCTTCGTCGTCGTCGTCGCGCTGCAGGTGGCCATGCTACTG
TATCCCGCCTTCTTGGGGCTCAGCCGAGACGCGAGACGGCTGGTCGACCCGTGCTCGGCAGTGCGACGGGCTCTA
CAGAGGCAGGACGAGGAAGAGATGACGATGGACGAGTTCGTGGTCCACAGGCACCGTATAGAGCGGCGGAGGCTT
CACAAGGGCGGGCTCTTGCGGCAGGCTTCCAGGAGCTTCGGCGCCAGGTTCGTCATGGCTCCGAGGAAACTATCG
CAGCAGGCAGACGTGGAGCACAGCGAGGGCGGCAGTCGGAGCCCGTGA
Transcript >Ophun1|504
ATGGACGGGCGCGTTCCGAATCGTGGTCCGGTCGTCTTCGCCGTCACCACTGCGACGCTTCTGCTCGCAACCGCC
TTCGTCGGCGCTCGCATTGTCTGTCGTCACTACATCGTCCGCAATGTGTCGTGGGACGACAGGGTCATGGCTTTG
GCCTGGCTCATCGCCTTGTTCCTCTCCTTCACCATCGACCTCGGTGCCGTCACGGGCCTGGGCAAGCATGACGCA
GACATATCGAAGCGTGATCTCGAAACGCTCCGTCGCTGCGAATATGTCTTTTCCATCTTATACAACCCGGCCCTC
ATGGCAACAAAGACCAGCGTCTTGATCTTCTACCTGCGCATCGCCAAGAATACCCAGGTCGTGCTGCGATACGCC
TCGTGGGCCACCCTGGTCGTCGTCAACGTCTCGGGCCTTGTCCTCACCTTTATCAACATCTTCCAGTGCAGTCCC
GTCGGCGCCGCCTGGATGGCCGGTGAAGATCACCAATCGTCGTGTATCCCGCTCCTCACAGAGTTCATCTGCGCT
GCTCCCATCAACATCGTCACCGACTTGGCCGTTCTCGCCCTGCCCATACCCGTCCTCACCGGCATGCGCCTCCCT
TCGCGGCAGAAGACGATCCTGGTGCTGACCTTTACCGTCGGCATCTTCGTCGCCATTGTTGACGTCATCCGCATC
TATTACCTTCAGCGCGCCGTCTCCAACGTCTTCATGGCGCCTTCGAGCCGTCCCGAGGCGAGATTCGGAGGCGAG
GCCGACTTTGCGTGGAACGCCTCGCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGCA
TGCGTGCCGGCCCTCAAGCCCCTGATTATGAAGCTGCTGCCTTCTATGCTGTACGATCCAGACGGGACCTGGGGC
TCTACCGAGTCCAGGGCTCCTGGCGACTTTATCCCCTCTCGCAAACGGTCGAGCCACGCTGCGTCGGCGTCTCCC
GTACTGGCACTCGGGTCTATCCATACCGATGACGGGCCACCGGTCAGCATCAACGACTTTTCCCCGGCGCCGGAC
GCGGCCTACCTCGGCTCCCCGGTCCCGGACTCGGCGCTCGCCGTGCGCACCCCGACGACGGCGACGACGGGCGAT
CACGGCGTGTACTTTGGCTTCGTTAACCTGGCCAAGCCCAAGAGCATGCTGAGGGCCAGCGCTGCGGACTCGCTG
CGATACTGCACCGTCGTCTCCATCCTCTTCTTCCTCTGGGGTCTCTCGTACGGTCTCCTCAACAGCCTTAATAAT
GCCGTCGCCGCCGTCAACCACATCTCGACGGCAAAGACGCTGGGCTTGACCAGCGCCTACTTCGGCGGCGGTTAC
TTGTTCGGCCCTCTGCTGGTGGGTGAATGGGTCCTGCGCCGGGATGAGCACAACCGTTCCAAGCGGCACGAAAAG
GACGGCGCTGAGAACGTGGGCGGCTTCAAGGCGACTTTCATCGTCGGCCTGTGCATCTACGGCATCGGGACCATG
ATCTTCTGGCCCTCGGCCGTGGCCAACTCGTACGGCGGCTTCATGCTCAGCAACTTCGTCGTCGGCTTCGGCCTC
TCGGTGCTCGAGGTGGGCGCCAACGCCTTCATGGTGCTCTGCGGTCCGCCCGAGTACGGCGAGACGCGGCTGCTA
CTGGCTCAAGGCGTCCAAGCCGTCGGCAGCGTCGTGAGCGGCGTTCTGGCGGACAAGGTCTTCTTCAAGGGCATC
GCTCGCGACAACCCCCACGACAGCATGACGCTCATCAACGTCCAGTGGACGTATCTCGGCATCACCCTTCTGTGT
GTCGTCCTCGGCCTCTTCTTCTTCTACATGCCGCTGCCCGAGGTCAGCGACGACGAGCTGCAACGGTCGGCGAGC
CAGTTACCCGTCGAGACGAACAAGAGGAGCGTCGGCGGCCTCGAGCTGCGGACCGTCTGCCTGGCGCTGGCCGTC
TTCGCCCAGTACGCCTACGTGGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGCCTCATTCTCTCGGCCGTG
CCCGAATCGTCGTCTCCGGTGAGGCAGCGCAGGGCGGCGGGCGGCGCGGGACACCTGGGGGGCGTTACCGACCCG
AACAGGCCGTTGGGGTTCGCCATCACCATGGCCGACTTTCTCCTGGTCGGACGCGCCATCTTTGCCCTGTCGCGC
TTCCTGATGGCCTTTCTCACCTTCTTGTCCGTCGGCCGTCGTCGGATGCCGCAACCGCGGACCTACCTGGCCATG
AGCGTGGGCCTATGCCTCGTGTCGTCGATGGTGCTCGTAGTGCGCCGGCCGTCGAGCCCGATACTACTCGCCACT
TGCGCTGCCGTCTTCTTCTTGGGCGAGGGTCCGATATGGCCCCTCGTCTTCGCCATCGGCCTCCGGGGTCAAGGC
TCGAGGACGAAGCGTGCCGCGGCCTTTATCACCATGGGTGGCGCCGGGCCGGCCTTTTTCCCATTCATCATGTAC
GGCATCGTCGAGAGCGGCAGAACATTGCAGACAGCCTTCGTCGTCGTCGTCGCGCTGCAGGTGGCCATGCTACTG
TATCCCGCCTTCTTGGGGCTCAGCCGAGACGCGAGACGGCTGGTCGACCCGTGCTCGGCAGTGCGACGGGCTCTA
CAGAGGCAGGACGAGGAAGAGATGACGATGGACGAGTTCGTGGTCCACAGGCACCGTATAGAGCGGCGGAGGCTT
CACAAGGGCGGGCTCTTGCGGCAGGCTTCCAGGAGCTTCGGCGCCAGGTTCGTCATGGCTCCGAGGAAACTATCG
CAGCAGGCAGACGTGGAGCACAGCGAGGGCGGCAGTCGGAGCCCGTGA
Gene >Ophun1|504
ATGGACGGGCGCGTTCCGAATCGTGGTCCGGTCGTCTTCGCCGTCACCACTGCGACGCTTCTGCTCGCAACCGCC
TTCGTCGGCGCTCGCATTGTCTGTCGTCACTACATCGTCCGCAATGTGTCGTGGGACGACAGGGTCATGGCTTTG
GCCTGGCTCATCGCCTTGTTCCTCTCCTTCACCATCGACCTCGGTGCCGTCACGGGCCTGGGCAAGCATGACGCA
GACATATCGAAGCGTGATCTCGAAACGCTCCGTCGCTGCGAATATGTCTTTTCCATCTTATACGTGCGTCTTCCT
CCCGTCCTTGCCTCTCGTCATGTCCGCTGACGGCGTATGGTGTATGTAGAACCCGGCCCTCATGGCAACAAAGAC
CAGCGTCTTGATCTTCTACCTGCGCATCGCCAAGAATACCCAGGTCGTGCTGCGATACGCCTCGTGGGCCACCCT
GGTCGTCGTCAACGTCTCGGGCCTTGTCCTCACCTTTATCAACATCTTCCAGTGCAGTCCCGTCGGCGCCGCCTG
GATGGCCGGTGAAGATCACCAATCGTCGTGTATCCCGCTCCTCACAGAGTTCATCTGCGCTGCTCCCATCAACAT
CGTCACCGACTTGGCCGTTCTCGCCCTGCCCATACCCGTCCTCACCGGCATGCGCCTCCCTTCGCGGCAGAAGAC
GATCCTGGTGCTGACCTTTACCGTCGGCATCTTCGTCGCCATTGTTGACGTCATCCGCATCTATTACCTTCAGCG
CGCCGTCTCCAACGTCTTCATGGCGCCTTCGAGCCGTCCCGAGGCGAGATTCGGAGGCGAGGCCGACTTTGCGTG
GAACGCCTCGCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGCATGCGTGCCGGCCCT
CAAGCCCCTGATTATGAAGCTGCTGCCTTCTATGCTGTACGATCCAGACGGGACCTGGGGCTCTACCGAGTCCAG
GGCTCCTGGCGACTTTATCCCCTCTCGCAAACGGTCGAGCCACGCTGCGTCGGCGTCTCCCGTACTGGCACTCGG
GTCTATCCATACCGATGACGGGCCACCGGTCAGCATCAACGACTTTTCCCCGGCGCCGGACGCGGCCTACCTCGG
CTCCCCGGTCCCGGACTCGGCGCTCGCCGTGCGCACCCCGACGACGGCGACGACGGGCGATCACGGCGTGTACTT
TGGCTTCGTTAACCTGGCCAAGCCCAAGAGCATGCTGAGGGCCAGCGCTGCGGACTCGCTGCGATACTGCACCGT
CGTCTCCATCCTCTTCTTCCTCTGGGGTCTCTCGTACGGTCTCCTCAACAGCCTTAATAATGCCGTCGCCGCCGT
CAACCACATCTCGACGGCAAAGACGCTGGGCTTGACCAGCGCCTACTTCGGCGGCGGTTACTTGTTCGGCCCTCT
GCTGGTGGGTGAATGGGTCCTGCGCCGGGATGAGCACAACCGTTCCAAGCGGCACGAAAAGGACGGCGCTGAGAA
CGTGGGCGGCTTCAAGGCGACTTTCATCGTCGGCCTGTGCATCTACGGCATCGGGACCATGATCTTCTGGCCCTC
GGCCGTGGCCAACTCGTACGGCGGCTTCATGCTCAGCAACTTCGTCGTCGGCTTCGGCCTCTCGGTGCTCGAGGT
GGGCGCCAACGCCTTCATGGTGCTCTGCGGTCCGCCCGAGTACGGCGAGACGCGGCTGCTACTGGCTCAAGGCGT
CCAAGCCGTCGGCAGCGTCGTGAGCGGCGTTCTGGCGGACAAGGTCTTCTTCAAGGGCATCGCTCGCGACAACCC
CCACGACAGCATGACGCTCATCAACGTCCAGTGGACGTATCTCGGCATCACCCTTCTGTGTGTCGTCCTCGGCCT
CTTCTTCTTCTACATGCCGCTGCCCGAGGTCAGCGACGACGAGCTGCAACGGTCGGCGAGCCAGTTACCCGTCGA
GACGAACAAGAGGAGCGTCGGCGGCCTCGAGCTGCGGACCGTCTGCCTGGCGCTGGCCGTCTTCGCCCAGTACGC
CTACGTGGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGCCTCATTCTCTCGGCCGTGCCCGAATCGTCGTC
TCCGGTGAGGCAGCGCAGGGCGGCGGGCGGCGCGGGACACCTGGGGGGCGTTACCGACCCGAACAGGCCGTTGGG
GTTCGCCATCACCATGGCCGACTTTCTCCTGGTCGGACGCGCCATCTTTGCCCTGTCGCGCTTCCTGATGGCCTT
TCTCACCTTCTTGTCCGTCGGCCGTCGTCGGATGCCGCAACCGCGGACCTACCTGGCCATGAGCGTGGGCCTATG
CCTCGTGTCGTCGATGGTGCTCGTAGTGCGCCGGCCGTCGAGCCCGATACTACTCGCCACTTGCGCTGCCGTCTT
CTTCTTGGGCGAGGGTCCGATATGGCCCCTCGTCTTCGCCATCGGCCTCCGGGGTCAAGGCTCGAGGACGAAGCG
TGCCGCGGCCTTTATCACCATGGGTGGCGCCGGGCCGGCCTTTTTCCCATTCATCATGTACGGCATCGTCGAGAG
CGGCAGAACATTGCAGACAGCCTTCGTCGTCGTCGTCGCGCTGCAGGTGGCCATGCTACTGTATCCCGCCTTCTT
GGGGCTCAGCCGAGACGCGAGACGGCTGGTCGACCCGTGCTCGGCAGTGCGACGGGCTCTACAGAGGCAGGACGA
GGAAGAGATGACGATGGACGAGTTCGTGGTCCACAGGCACCGTATAGAGCGGCGGAGGCTTCACAAGGGCGGGCT
CTTGCGGCAGGCTTCCAGGAGCTTCGGCGCCAGGTTCGTCATGGCTCCGAGGAAACTATCGCAGCAGGCAGACGT
GGAGCACAGCGAGGGCGGCAGTCGGAGCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail