Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5034
Gene name
LocationContig_481:935..4469
Strand-
Gene length (bp)3534
Transcript length (bp)3534
Coding sequence length (bp)3534
Protein length (aa) 1178

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999676

Transmembrane Domains

Domain # Start End Length
1 1075 1097 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4719
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3374
Ophiocordyceps australis map64 (Brazil) OphauB2|6065
Ophiocordyceps camponoti-floridani Ophcf2|06382
Ophiocordyceps camponoti-rufipedis Ophun1|5034 (this protein)
Ophiocordyceps kimflemingae Ophio5|3333
Ophiocordyceps subramaniannii Hirsu2|9943

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5034
MHTKSNAVTVALALIGFVAAGPDPEQPRINEITRPTFNSTSSSSQALTGTANSFSTDPDVSSSGQRMLEGLLASL
LRTDTQAFTTEGDDSLLTSVTDAPQETGTLPYSTTVKPGSTQRSELASHDSTQKPSTDRPASGSTSTSGPSSNEG
PSDRSRPASSNTQASSSPDTTLQKPSPNKPEIASTQKLAVSNKGAFQGPSTGSPGSATTQKPASPSHDSPQGSTN
SKPEQSPTSHHTARGSSSGSVYQPGTSSHDSAQRSSTVKPEPSSTSKRDTTRNSHLDLPSDVGIVIGPNGIVTSS
PSATPTSRETSPDAHPPTTTPSAAPSTSENEIDVEPPVAGGKVGLRKGVKMPPTEKVVKQPVTNVGATLPTPPAN
GSSSEPAEPLASSSSSTKDGILAPVSHIASGLVPLPGAKTSSSAPAVVYSTSSVPVPTTKAEFPASTSNAAVPAS
SDVGQGRVIPIPSNRDVFSRPGGSGVGTPSASASSTAASVPTSVVAPIGKVAPMTSRTTRADPVGSTYSGVDASS
VTSRPNSTEAETQTNGLLPVVTSKVPLLTPLVPAVNSILPGPANSTAPATLSSSTVVASSHLSDPTAISTSSLTD
PTVPPPIAVSPTGTAPTAKTRLAVPSSSVSSSVRDTATETLISANSSSAYTAPPTASPTKSDGLTPLLSSLLSPT
SVLSDLTLNTTLSIPSTAPSQSLPLTSNLLNTTTASTVVEVPVTSTPSTTSLETATSSLTTGLSSLPTTMPVTNA
TSSSDLSSQSTKAVLNTTTSAAPEITASSTASTTTELPLSTSVANTTDTTTKTSLYRLPPSSTHTTSSSSTLSSE
DGSTTVESTISSHDPTAAVTTEHKASSTVVSQMPSSSSVSSTSQSSSEPPLPPPTSFPKYIAPSKPAASAPVGTR
NITIALNNMVMKNGIDAISTYNIISRLLPTLISLSLASRSADKIVVFSLERCGASAQSFNFLARTSFPDDEAFVS
QLQMNLGLPNSPIYTTTAPELTGLIDKNLKAAGQSMTATDTEAAMKLRENLDKFHNVTIEHCITKGTGQDANNGG
DLGSNGNAPNAPNPGNQTEKDKLKTMVITMGMVAGAFVYGAAMFILARRYKRKRQTHRRSSSVSNSQESSEMAQP
SPALMGGALANRDHFHGEGRDSRGSGRSGMANSGRTANISAPVAAENSLGWS*
Coding >Ophun1|5034
ATGCACACCAAGTCGAACGCTGTCACCGTGGCATTGGCCTTGATCGGATTCGTCGCGGCCGGACCAGACCCCGAA
CAGCCTCGCATCAACGAAATCACGCGCCCTACCTTCAACTCAACCTCGTCTTCCTCCCAAGCCTTGACCGGGACG
GCCAACAGCTTCTCGACAGATCCTGATGTCTCTTCCTCGGGTCAGCGCATGCTCGAAGGACTCCTTGCTAGCCTC
TTGCGTACCGATACCCAAGCATTTACGACCGAAGGAGATGACTCCCTCCTGACGTCCGTCACCGACGCTCCCCAG
GAGACTGGCACATTGCCCTATTCCACCACCGTCAAGCCCGGTTCAACGCAGAGATCGGAGCTGGCCAGCCACGAC
AGCACGCAGAAACCGTCTACCGACAGGCCCGCGTCGGGCTCGACCTCCACTTCGGGACCGTCCAGCAACGAGGGG
CCTTCTGACAGGTCTCGACCTGCCTCGTCGAACACGCAGGCATCGTCAAGCCCCGACACCACCCTCCAGAAGCCG
TCGCCTAACAAGCCCGAGATTGCCTCGACGCAGAAACTCGCCGTGTCTAATAAAGGCGCTTTCCAGGGACCATCA
ACTGGATCGCCCGGGTCTGCAACGACTCAGAAGCCGGCGTCGCCCAGTCACGACAGCCCCCAGGGATCGACAAAT
AGCAAGCCCGAGCAGAGCCCGACGAGCCATCACACCGCCCGGGGATCGTCTTCTGGGTCCGTGTACCAGCCGGGA
ACGTCCAGTCACGACAGCGCTCAGAGATCGTCGACTGTAAAGCCTGAGCCCAGCTCGACCTCGAAGCGGGATACG
ACTCGCAACAGCCATCTCGATTTGCCATCTGACGTCGGCATCGTGATTGGTCCCAACGGCATCGTCACCTCTTCT
CCCAGCGCGACCCCGACGTCTAGGGAGACTTCTCCGGACGCACACCCTCCCACGACTACCCCCAGCGCTGCGCCG
TCCACCTCTGAAAACGAGATCGACGTTGAGCCGCCCGTCGCCGGGGGAAAAGTAGGTCTCAGGAAAGGTGTCAAG
ATGCCTCCCACGGAAAAGGTGGTCAAGCAGCCCGTCACCAACGTCGGCGCCACGCTGCCCACTCCCCCGGCCAAT
GGCTCCTCGTCGGAACCTGCTGAGCCGCTGGCATCTTCATCGTCGAGCACCAAAGATGGCATCCTGGCTCCCGTC
AGCCATATTGCGAGTGGCCTCGTGCCGCTTCCGGGCGCCAAGACGTCTTCTTCTGCTCCCGCGGTTGTCTACAGC
ACTTCGTCTGTACCTGTTCCAACAACCAAAGCTGAGTTTCCCGCCTCGACATCCAATGCCGCTGTTCCTGCCTCG
AGCGACGTCGGTCAAGGCCGCGTCATCCCGATTCCCAGTAACCGTGACGTCTTCTCGCGTCCTGGAGGCTCCGGC
GTCGGCACCCCCTCGGCGTCGGCTTCTTCGACCGCGGCCAGTGTCCCGACCTCTGTGGTCGCTCCCATCGGCAAG
GTTGCGCCCATGACCAGCCGGACGACCCGCGCGGATCCTGTGGGATCGACATACAGCGGTGTTGATGCTTCCTCT
GTGACGTCGCGCCCAAACAGCACTGAGGCTGAGACGCAGACCAACGGTCTTCTTCCGGTCGTGACGTCCAAGGTG
CCTCTCCTGACTCCTCTGGTGCCCGCGGTCAACAGTATCCTGCCTGGACCAGCCAATTCGACGGCTCCGGCGACA
CTTTCAAGCTCGACGGTGGTGGCGAGCAGCCACCTGTCGGATCCAACTGCCATCTCGACGAGCTCTCTCACGGAT
CCGACGGTACCGCCGCCGATTGCCGTCTCGCCTACCGGAACTGCGCCGACGGCCAAGACCAGATTGGCCGTGCCG
TCGTCGTCTGTCAGCTCTTCCGTCAGGGACACTGCAACGGAGACGCTGATCTCTGCCAACTCTTCGTCCGCATAC
ACGGCGCCCCCGACGGCCAGCCCAACCAAATCGGACGGGCTGACACCGCTTCTCTCTTCGCTTCTCTCGCCAACG
TCGGTCTTGTCCGACTTGACGCTCAACACGACGCTCAGTATTCCATCGACGGCCCCGAGCCAGTCACTGCCTCTC
ACCTCGAATCTGCTGAATACCACCACCGCCAGCACCGTGGTCGAGGTCCCAGTGACGAGTACGCCGAGTACGACG
AGTCTCGAGACGGCAACCAGCTCTCTGACGACAGGCTTGAGTTCGCTACCCACCACCATGCCCGTCACCAATGCT
ACGAGCTCGAGTGATCTGTCGAGCCAGTCCACCAAAGCGGTCCTCAACACCACGACGTCGGCCGCGCCAGAGATT
ACTGCGTCGTCCACGGCATCGACCACAACGGAGCTGCCGTTGTCGACGTCTGTGGCAAACACGACGGATACGACA
ACCAAGACGTCGCTGTATCGTCTCCCGCCCTCGTCGACGCACACGACGTCTTCGAGCAGCACGCTGAGTTCCGAG
GATGGCTCGACGACGGTGGAGTCGACCATCAGTAGCCACGACCCGACTGCGGCGGTGACGACGGAACACAAGGCC
TCTTCTACGGTAGTCTCGCAGATGCCTTCTTCGTCGTCAGTGTCGTCGACAAGCCAGTCGTCGTCGGAACCGCCT
CTTCCACCCCCCACGAGCTTCCCCAAGTACATCGCCCCCAGCAAGCCGGCGGCATCGGCGCCAGTGGGCACGAGG
AACATTACGATTGCTCTCAACAACATGGTGATGAAGAACGGCATCGATGCCATCTCGACTTACAACATCATCTCG
AGGCTACTCCCTACCCTCATCTCGCTGAGTCTCGCGTCGCGGAGTGCGGATAAGATTGTCGTCTTCAGTCTGGAG
AGGTGCGGCGCATCGGCCCAATCGTTCAACTTTCTGGCGCGCACGAGCTTCCCGGACGACGAGGCCTTTGTGAGC
CAGCTCCAGATGAACCTGGGACTGCCCAACTCGCCCATCTACACGACGACGGCGCCCGAGTTGACCGGGTTGATC
GACAAGAACCTCAAGGCGGCGGGCCAGTCGATGACGGCGACGGACACGGAGGCGGCCATGAAGCTGAGGGAGAAT
CTCGACAAGTTCCACAACGTCACCATCGAGCACTGCATCACAAAGGGCACGGGTCAGGACGCCAACAACGGCGGT
GACCTGGGCTCCAACGGCAACGCACCCAACGCGCCCAACCCTGGCAACCAGACGGAAAAGGATAAGCTGAAGACG
ATGGTCATTACCATGGGAATGGTGGCAGGGGCCTTTGTGTACGGAGCGGCCATGTTCATCCTCGCTCGACGGTAC
AAGCGCAAGAGGCAGACGCACCGTCGGTCCAGCTCCGTGTCCAACAGCCAGGAGTCGTCGGAGATGGCCCAGCCC
AGCCCGGCTCTCATGGGAGGCGCTCTTGCGAACCGCGACCACTTCCACGGCGAGGGACGGGACAGCCGTGGCAGC
GGACGCAGCGGCATGGCCAACTCGGGCCGGACGGCCAACATCTCGGCTCCCGTGGCGGCGGAGAACTCGCTGGGC
TGGAGCTGA
Transcript >Ophun1|5034
ATGCACACCAAGTCGAACGCTGTCACCGTGGCATTGGCCTTGATCGGATTCGTCGCGGCCGGACCAGACCCCGAA
CAGCCTCGCATCAACGAAATCACGCGCCCTACCTTCAACTCAACCTCGTCTTCCTCCCAAGCCTTGACCGGGACG
GCCAACAGCTTCTCGACAGATCCTGATGTCTCTTCCTCGGGTCAGCGCATGCTCGAAGGACTCCTTGCTAGCCTC
TTGCGTACCGATACCCAAGCATTTACGACCGAAGGAGATGACTCCCTCCTGACGTCCGTCACCGACGCTCCCCAG
GAGACTGGCACATTGCCCTATTCCACCACCGTCAAGCCCGGTTCAACGCAGAGATCGGAGCTGGCCAGCCACGAC
AGCACGCAGAAACCGTCTACCGACAGGCCCGCGTCGGGCTCGACCTCCACTTCGGGACCGTCCAGCAACGAGGGG
CCTTCTGACAGGTCTCGACCTGCCTCGTCGAACACGCAGGCATCGTCAAGCCCCGACACCACCCTCCAGAAGCCG
TCGCCTAACAAGCCCGAGATTGCCTCGACGCAGAAACTCGCCGTGTCTAATAAAGGCGCTTTCCAGGGACCATCA
ACTGGATCGCCCGGGTCTGCAACGACTCAGAAGCCGGCGTCGCCCAGTCACGACAGCCCCCAGGGATCGACAAAT
AGCAAGCCCGAGCAGAGCCCGACGAGCCATCACACCGCCCGGGGATCGTCTTCTGGGTCCGTGTACCAGCCGGGA
ACGTCCAGTCACGACAGCGCTCAGAGATCGTCGACTGTAAAGCCTGAGCCCAGCTCGACCTCGAAGCGGGATACG
ACTCGCAACAGCCATCTCGATTTGCCATCTGACGTCGGCATCGTGATTGGTCCCAACGGCATCGTCACCTCTTCT
CCCAGCGCGACCCCGACGTCTAGGGAGACTTCTCCGGACGCACACCCTCCCACGACTACCCCCAGCGCTGCGCCG
TCCACCTCTGAAAACGAGATCGACGTTGAGCCGCCCGTCGCCGGGGGAAAAGTAGGTCTCAGGAAAGGTGTCAAG
ATGCCTCCCACGGAAAAGGTGGTCAAGCAGCCCGTCACCAACGTCGGCGCCACGCTGCCCACTCCCCCGGCCAAT
GGCTCCTCGTCGGAACCTGCTGAGCCGCTGGCATCTTCATCGTCGAGCACCAAAGATGGCATCCTGGCTCCCGTC
AGCCATATTGCGAGTGGCCTCGTGCCGCTTCCGGGCGCCAAGACGTCTTCTTCTGCTCCCGCGGTTGTCTACAGC
ACTTCGTCTGTACCTGTTCCAACAACCAAAGCTGAGTTTCCCGCCTCGACATCCAATGCCGCTGTTCCTGCCTCG
AGCGACGTCGGTCAAGGCCGCGTCATCCCGATTCCCAGTAACCGTGACGTCTTCTCGCGTCCTGGAGGCTCCGGC
GTCGGCACCCCCTCGGCGTCGGCTTCTTCGACCGCGGCCAGTGTCCCGACCTCTGTGGTCGCTCCCATCGGCAAG
GTTGCGCCCATGACCAGCCGGACGACCCGCGCGGATCCTGTGGGATCGACATACAGCGGTGTTGATGCTTCCTCT
GTGACGTCGCGCCCAAACAGCACTGAGGCTGAGACGCAGACCAACGGTCTTCTTCCGGTCGTGACGTCCAAGGTG
CCTCTCCTGACTCCTCTGGTGCCCGCGGTCAACAGTATCCTGCCTGGACCAGCCAATTCGACGGCTCCGGCGACA
CTTTCAAGCTCGACGGTGGTGGCGAGCAGCCACCTGTCGGATCCAACTGCCATCTCGACGAGCTCTCTCACGGAT
CCGACGGTACCGCCGCCGATTGCCGTCTCGCCTACCGGAACTGCGCCGACGGCCAAGACCAGATTGGCCGTGCCG
TCGTCGTCTGTCAGCTCTTCCGTCAGGGACACTGCAACGGAGACGCTGATCTCTGCCAACTCTTCGTCCGCATAC
ACGGCGCCCCCGACGGCCAGCCCAACCAAATCGGACGGGCTGACACCGCTTCTCTCTTCGCTTCTCTCGCCAACG
TCGGTCTTGTCCGACTTGACGCTCAACACGACGCTCAGTATTCCATCGACGGCCCCGAGCCAGTCACTGCCTCTC
ACCTCGAATCTGCTGAATACCACCACCGCCAGCACCGTGGTCGAGGTCCCAGTGACGAGTACGCCGAGTACGACG
AGTCTCGAGACGGCAACCAGCTCTCTGACGACAGGCTTGAGTTCGCTACCCACCACCATGCCCGTCACCAATGCT
ACGAGCTCGAGTGATCTGTCGAGCCAGTCCACCAAAGCGGTCCTCAACACCACGACGTCGGCCGCGCCAGAGATT
ACTGCGTCGTCCACGGCATCGACCACAACGGAGCTGCCGTTGTCGACGTCTGTGGCAAACACGACGGATACGACA
ACCAAGACGTCGCTGTATCGTCTCCCGCCCTCGTCGACGCACACGACGTCTTCGAGCAGCACGCTGAGTTCCGAG
GATGGCTCGACGACGGTGGAGTCGACCATCAGTAGCCACGACCCGACTGCGGCGGTGACGACGGAACACAAGGCC
TCTTCTACGGTAGTCTCGCAGATGCCTTCTTCGTCGTCAGTGTCGTCGACAAGCCAGTCGTCGTCGGAACCGCCT
CTTCCACCCCCCACGAGCTTCCCCAAGTACATCGCCCCCAGCAAGCCGGCGGCATCGGCGCCAGTGGGCACGAGG
AACATTACGATTGCTCTCAACAACATGGTGATGAAGAACGGCATCGATGCCATCTCGACTTACAACATCATCTCG
AGGCTACTCCCTACCCTCATCTCGCTGAGTCTCGCGTCGCGGAGTGCGGATAAGATTGTCGTCTTCAGTCTGGAG
AGGTGCGGCGCATCGGCCCAATCGTTCAACTTTCTGGCGCGCACGAGCTTCCCGGACGACGAGGCCTTTGTGAGC
CAGCTCCAGATGAACCTGGGACTGCCCAACTCGCCCATCTACACGACGACGGCGCCCGAGTTGACCGGGTTGATC
GACAAGAACCTCAAGGCGGCGGGCCAGTCGATGACGGCGACGGACACGGAGGCGGCCATGAAGCTGAGGGAGAAT
CTCGACAAGTTCCACAACGTCACCATCGAGCACTGCATCACAAAGGGCACGGGTCAGGACGCCAACAACGGCGGT
GACCTGGGCTCCAACGGCAACGCACCCAACGCGCCCAACCCTGGCAACCAGACGGAAAAGGATAAGCTGAAGACG
ATGGTCATTACCATGGGAATGGTGGCAGGGGCCTTTGTGTACGGAGCGGCCATGTTCATCCTCGCTCGACGGTAC
AAGCGCAAGAGGCAGACGCACCGTCGGTCCAGCTCCGTGTCCAACAGCCAGGAGTCGTCGGAGATGGCCCAGCCC
AGCCCGGCTCTCATGGGAGGCGCTCTTGCGAACCGCGACCACTTCCACGGCGAGGGACGGGACAGCCGTGGCAGC
GGACGCAGCGGCATGGCCAACTCGGGCCGGACGGCCAACATCTCGGCTCCCGTGGCGGCGGAGAACTCGCTGGGC
TGGAGCTGA
Gene >Ophun1|5034
ATGCACACCAAGTCGAACGCTGTCACCGTGGCATTGGCCTTGATCGGATTCGTCGCGGCCGGACCAGACCCCGAA
CAGCCTCGCATCAACGAAATCACGCGCCCTACCTTCAACTCAACCTCGTCTTCCTCCCAAGCCTTGACCGGGACG
GCCAACAGCTTCTCGACAGATCCTGATGTCTCTTCCTCGGGTCAGCGCATGCTCGAAGGACTCCTTGCTAGCCTC
TTGCGTACCGATACCCAAGCATTTACGACCGAAGGAGATGACTCCCTCCTGACGTCCGTCACCGACGCTCCCCAG
GAGACTGGCACATTGCCCTATTCCACCACCGTCAAGCCCGGTTCAACGCAGAGATCGGAGCTGGCCAGCCACGAC
AGCACGCAGAAACCGTCTACCGACAGGCCCGCGTCGGGCTCGACCTCCACTTCGGGACCGTCCAGCAACGAGGGG
CCTTCTGACAGGTCTCGACCTGCCTCGTCGAACACGCAGGCATCGTCAAGCCCCGACACCACCCTCCAGAAGCCG
TCGCCTAACAAGCCCGAGATTGCCTCGACGCAGAAACTCGCCGTGTCTAATAAAGGCGCTTTCCAGGGACCATCA
ACTGGATCGCCCGGGTCTGCAACGACTCAGAAGCCGGCGTCGCCCAGTCACGACAGCCCCCAGGGATCGACAAAT
AGCAAGCCCGAGCAGAGCCCGACGAGCCATCACACCGCCCGGGGATCGTCTTCTGGGTCCGTGTACCAGCCGGGA
ACGTCCAGTCACGACAGCGCTCAGAGATCGTCGACTGTAAAGCCTGAGCCCAGCTCGACCTCGAAGCGGGATACG
ACTCGCAACAGCCATCTCGATTTGCCATCTGACGTCGGCATCGTGATTGGTCCCAACGGCATCGTCACCTCTTCT
CCCAGCGCGACCCCGACGTCTAGGGAGACTTCTCCGGACGCACACCCTCCCACGACTACCCCCAGCGCTGCGCCG
TCCACCTCTGAAAACGAGATCGACGTTGAGCCGCCCGTCGCCGGGGGAAAAGTAGGTCTCAGGAAAGGTGTCAAG
ATGCCTCCCACGGAAAAGGTGGTCAAGCAGCCCGTCACCAACGTCGGCGCCACGCTGCCCACTCCCCCGGCCAAT
GGCTCCTCGTCGGAACCTGCTGAGCCGCTGGCATCTTCATCGTCGAGCACCAAAGATGGCATCCTGGCTCCCGTC
AGCCATATTGCGAGTGGCCTCGTGCCGCTTCCGGGCGCCAAGACGTCTTCTTCTGCTCCCGCGGTTGTCTACAGC
ACTTCGTCTGTACCTGTTCCAACAACCAAAGCTGAGTTTCCCGCCTCGACATCCAATGCCGCTGTTCCTGCCTCG
AGCGACGTCGGTCAAGGCCGCGTCATCCCGATTCCCAGTAACCGTGACGTCTTCTCGCGTCCTGGAGGCTCCGGC
GTCGGCACCCCCTCGGCGTCGGCTTCTTCGACCGCGGCCAGTGTCCCGACCTCTGTGGTCGCTCCCATCGGCAAG
GTTGCGCCCATGACCAGCCGGACGACCCGCGCGGATCCTGTGGGATCGACATACAGCGGTGTTGATGCTTCCTCT
GTGACGTCGCGCCCAAACAGCACTGAGGCTGAGACGCAGACCAACGGTCTTCTTCCGGTCGTGACGTCCAAGGTG
CCTCTCCTGACTCCTCTGGTGCCCGCGGTCAACAGTATCCTGCCTGGACCAGCCAATTCGACGGCTCCGGCGACA
CTTTCAAGCTCGACGGTGGTGGCGAGCAGCCACCTGTCGGATCCAACTGCCATCTCGACGAGCTCTCTCACGGAT
CCGACGGTACCGCCGCCGATTGCCGTCTCGCCTACCGGAACTGCGCCGACGGCCAAGACCAGATTGGCCGTGCCG
TCGTCGTCTGTCAGCTCTTCCGTCAGGGACACTGCAACGGAGACGCTGATCTCTGCCAACTCTTCGTCCGCATAC
ACGGCGCCCCCGACGGCCAGCCCAACCAAATCGGACGGGCTGACACCGCTTCTCTCTTCGCTTCTCTCGCCAACG
TCGGTCTTGTCCGACTTGACGCTCAACACGACGCTCAGTATTCCATCGACGGCCCCGAGCCAGTCACTGCCTCTC
ACCTCGAATCTGCTGAATACCACCACCGCCAGCACCGTGGTCGAGGTCCCAGTGACGAGTACGCCGAGTACGACG
AGTCTCGAGACGGCAACCAGCTCTCTGACGACAGGCTTGAGTTCGCTACCCACCACCATGCCCGTCACCAATGCT
ACGAGCTCGAGTGATCTGTCGAGCCAGTCCACCAAAGCGGTCCTCAACACCACGACGTCGGCCGCGCCAGAGATT
ACTGCGTCGTCCACGGCATCGACCACAACGGAGCTGCCGTTGTCGACGTCTGTGGCAAACACGACGGATACGACA
ACCAAGACGTCGCTGTATCGTCTCCCGCCCTCGTCGACGCACACGACGTCTTCGAGCAGCACGCTGAGTTCCGAG
GATGGCTCGACGACGGTGGAGTCGACCATCAGTAGCCACGACCCGACTGCGGCGGTGACGACGGAACACAAGGCC
TCTTCTACGGTAGTCTCGCAGATGCCTTCTTCGTCGTCAGTGTCGTCGACAAGCCAGTCGTCGTCGGAACCGCCT
CTTCCACCCCCCACGAGCTTCCCCAAGTACATCGCCCCCAGCAAGCCGGCGGCATCGGCGCCAGTGGGCACGAGG
AACATTACGATTGCTCTCAACAACATGGTGATGAAGAACGGCATCGATGCCATCTCGACTTACAACATCATCTCG
AGGCTACTCCCTACCCTCATCTCGCTGAGTCTCGCGTCGCGGAGTGCGGATAAGATTGTCGTCTTCAGTCTGGAG
AGGTGCGGCGCATCGGCCCAATCGTTCAACTTTCTGGCGCGCACGAGCTTCCCGGACGACGAGGCCTTTGTGAGC
CAGCTCCAGATGAACCTGGGACTGCCCAACTCGCCCATCTACACGACGACGGCGCCCGAGTTGACCGGGTTGATC
GACAAGAACCTCAAGGCGGCGGGCCAGTCGATGACGGCGACGGACACGGAGGCGGCCATGAAGCTGAGGGAGAAT
CTCGACAAGTTCCACAACGTCACCATCGAGCACTGCATCACAAAGGGCACGGGTCAGGACGCCAACAACGGCGGT
GACCTGGGCTCCAACGGCAACGCACCCAACGCGCCCAACCCTGGCAACCAGACGGAAAAGGATAAGCTGAAGACG
ATGGTCATTACCATGGGAATGGTGGCAGGGGCCTTTGTGTACGGAGCGGCCATGTTCATCCTCGCTCGACGGTAC
AAGCGCAAGAGGCAGACGCACCGTCGGTCCAGCTCCGTGTCCAACAGCCAGGAGTCGTCGGAGATGGCCCAGCCC
AGCCCGGCTCTCATGGGAGGCGCTCTTGCGAACCGCGACCACTTCCACGGCGAGGGACGGGACAGCCGTGGCAGC
GGACGCAGCGGCATGGCCAACTCGGGCCGGACGGCCAACATCTCGGCTCCCGTGGCGGCGGAGAACTCGCTGGGC
TGGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail