Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5018
Gene name
LocationContig_48:8990..11154
Strand+
Gene length (bp)2164
Transcript length (bp)2097
Coding sequence length (bp)2097
Protein length (aa) 699

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13041 PPR_2 PPR repeat family 1.1E-15 127 172
PF01535 PPR PPR repeat 1.5E-04 127 156
PF13812 PPR_3 Pentatricopeptide repeat domain 5.8E-04 129 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60142|PPR2_SCHPO Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr2 PE=3 SV=1 92 345 6.0E-12
sp|Q9SF38|PP222_ARATH Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 108 330 3.0E-07
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 100 246 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5018
MAAGILRFSSVLRKLVVAELSPSSYSALLLRGRRQPYSTLSDSAIYDLITENVTEDAPSRHKRILEENSQDQTPS
LARLQRIVQRHLSHMQDPWKIAQYVQATLDKDRFDEALLLVQTASRDRAVEVSWNLLISYQIKKKQLKRAIQLFN
EMKKRGQLPNVSSYTILITGCAASEHPKQAVAEAVKQYQVLLSSPRLKANTIHLNCALNVCGRAGDLESLFIVAD
SINDTSRAPDAATYLIILNALRQDAMTKTEGLPFTQQEALKQKAIDRGKGIWQEVMSKWKGGRLNMDEGLACAMG
RLLLITPQRKERPQVLDILQQALNVPNLTKKPLDDTDPFEDPAMKDIALRETSSKTRQAVPGRNTLALILTTLAS
CKMTTVGIKYWNLMVRHYGIVPDRDNWYRMLGMTKVSRNSAYAAELLEILPDEFVCGKPFQIAMAACIRDSVNPN
VMANVNKALDIMLRRLTLPDMLALRLYLRVALVTHSSFRGEAMRGHLASGKHQYGAQIAAAVARVWEPYKKNYYH
YFKVEPKPPGRRDVTDEIYNSQREVMALARGMYRAIAKLDNEGLQSKEELKELRRRGAKINREIQTFYADREKLE
PKLRSSAVRSGEPDPHSSELNTALPPLSDDEALSDFGDEDLLPGGLVPDEGDDRDLVQKFEWEWDTTKPVVSPQN
KKSAKFKTVKPSSPTREPLEATI*
Coding >Ophun1|5018
ATGGCGGCCGGTATCCTGCGCTTCTCCAGCGTCCTGCGCAAATTGGTCGTCGCCGAACTCAGCCCATCGTCTTAC
AGCGCGCTCTTGTTGAGAGGCCGAAGGCAGCCTTACTCGACTTTGTCGGATTCCGCCATCTACGACCTTATCACA
GAAAATGTGACTGAAGATGCGCCGAGTCGTCATAAGCGGATTCTCGAAGAAAATTCCCAGGATCAGACGCCGTCT
TTGGCCAGGCTACAACGCATCGTCCAGAGGCATCTCTCCCACATGCAAGATCCGTGGAAGATTGCTCAATATGTT
CAGGCGACGTTGGACAAGGACCGCTTCGACGAGGCTCTACTACTGGTGCAGACGGCTAGCAGAGACCGCGCAGTC
GAGGTGTCCTGGAACCTGCTCATCTCCTACCAGATCAAGAAAAAGCAGCTGAAGAGGGCAATTCAACTGTTCAAC
GAGATGAAAAAAAGAGGCCAGCTCCCCAACGTCAGCTCCTATACCATCCTCATCACCGGCTGCGCAGCTTCTGAG
CACCCCAAGCAAGCCGTTGCCGAGGCCGTCAAGCAGTATCAAGTCCTCCTCAGCAGCCCTCGCCTCAAGGCCAAC
ACAATTCATCTCAACTGCGCGCTCAACGTCTGTGGCAGGGCCGGTGACCTCGAGTCTTTATTCATCGTTGCCGAC
TCCATCAACGACACGAGCCGCGCCCCTGACGCCGCGACATACTTAATCATACTAAACGCACTTCGCCAAGATGCC
ATGACCAAGACGGAAGGCTTACCGTTTACGCAGCAAGAGGCCCTCAAGCAAAAGGCCATCGACCGCGGCAAGGGT
ATATGGCAAGAGGTCATGAGCAAGTGGAAAGGGGGTCGGCTGAACATGGACGAGGGTCTCGCATGCGCCATGGGC
CGTCTCCTCCTCATCACTCCTCAGCGCAAGGAAAGGCCTCAAGTGCTGGATATTTTGCAACAGGCGTTGAACGTA
CCAAACCTGACCAAGAAGCCGCTTGATGATACGGATCCTTTTGAAGATCCTGCCATGAAAGACATTGCTCTCCGC
GAGACTTCCTCCAAGACGAGGCAGGCCGTTCCCGGGCGAAACACGCTTGCACTCATCCTCACGACGCTGGCGTCC
TGCAAGATGACAACTGTCGGCATCAAGTACTGGAACCTCATGGTCCGCCACTACGGCATCGTCCCGGACAGGGAT
AACTGGTACCGTATGCTGGGCATGACCAAGGTCTCCCGGAACAGCGCCTACGCGGCCGAGCTGCTGGAAATATTA
CCAGACGAATTCGTCTGCGGCAAGCCCTTCCAAATCGCCATGGCGGCATGCATACGAGACAGCGTCAACCCCAAC
GTCATGGCAAACGTCAACAAGGCCCTGGACATCATGTTGAGACGCCTCACTCTTCCAGATATGCTCGCGCTCCGC
CTCTACCTGCGCGTCGCCCTCGTCACTCACTCCAGCTTCCGCGGCGAGGCTATGCGCGGCCACTTAGCCTCGGGC
AAGCACCAGTACGGCGCCCAGATCGCGGCCGCCGTGGCCCGCGTGTGGGAGCCCTACAAGAAAAACTACTACCAC
TACTTCAAGGTCGAGCCCAAGCCACCAGGCCGCCGCGACGTCACCGACGAAATCTACAACAGCCAGCGCGAGGTC
ATGGCCCTCGCCCGCGGCATGTACAGGGCCATCGCTAAGCTTGACAACGAGGGCCTGCAGTCGAAGGAGGAGCTA
AAGGAGTTGCGCCGCCGAGGCGCGAAGATCAACCGCGAAATCCAGACCTTTTACGCCGATCGCGAGAAGCTGGAG
CCCAAGCTGAGGTCCAGCGCAGTTCGGTCAGGAGAGCCGGATCCTCACTCGTCCGAACTCAACACTGCCTTGCCC
CCTCTCAGCGATGACGAGGCCTTGTCCGACTTTGGCGACGAAGATCTGCTTCCCGGCGGCCTTGTGCCCGACGAA
GGGGACGACCGGGACCTCGTCCAGAAGTTTGAGTGGGAATGGGACACGACCAAACCAGTGGTAAGCCCACAGAAC
AAGAAATCGGCCAAGTTCAAAACGGTCAAGCCGTCATCACCGACCAGGGAGCCATTGGAAGCTACCATCTAG
Transcript >Ophun1|5018
ATGGCGGCCGGTATCCTGCGCTTCTCCAGCGTCCTGCGCAAATTGGTCGTCGCCGAACTCAGCCCATCGTCTTAC
AGCGCGCTCTTGTTGAGAGGCCGAAGGCAGCCTTACTCGACTTTGTCGGATTCCGCCATCTACGACCTTATCACA
GAAAATGTGACTGAAGATGCGCCGAGTCGTCATAAGCGGATTCTCGAAGAAAATTCCCAGGATCAGACGCCGTCT
TTGGCCAGGCTACAACGCATCGTCCAGAGGCATCTCTCCCACATGCAAGATCCGTGGAAGATTGCTCAATATGTT
CAGGCGACGTTGGACAAGGACCGCTTCGACGAGGCTCTACTACTGGTGCAGACGGCTAGCAGAGACCGCGCAGTC
GAGGTGTCCTGGAACCTGCTCATCTCCTACCAGATCAAGAAAAAGCAGCTGAAGAGGGCAATTCAACTGTTCAAC
GAGATGAAAAAAAGAGGCCAGCTCCCCAACGTCAGCTCCTATACCATCCTCATCACCGGCTGCGCAGCTTCTGAG
CACCCCAAGCAAGCCGTTGCCGAGGCCGTCAAGCAGTATCAAGTCCTCCTCAGCAGCCCTCGCCTCAAGGCCAAC
ACAATTCATCTCAACTGCGCGCTCAACGTCTGTGGCAGGGCCGGTGACCTCGAGTCTTTATTCATCGTTGCCGAC
TCCATCAACGACACGAGCCGCGCCCCTGACGCCGCGACATACTTAATCATACTAAACGCACTTCGCCAAGATGCC
ATGACCAAGACGGAAGGCTTACCGTTTACGCAGCAAGAGGCCCTCAAGCAAAAGGCCATCGACCGCGGCAAGGGT
ATATGGCAAGAGGTCATGAGCAAGTGGAAAGGGGGTCGGCTGAACATGGACGAGGGTCTCGCATGCGCCATGGGC
CGTCTCCTCCTCATCACTCCTCAGCGCAAGGAAAGGCCTCAAGTGCTGGATATTTTGCAACAGGCGTTGAACGTA
CCAAACCTGACCAAGAAGCCGCTTGATGATACGGATCCTTTTGAAGATCCTGCCATGAAAGACATTGCTCTCCGC
GAGACTTCCTCCAAGACGAGGCAGGCCGTTCCCGGGCGAAACACGCTTGCACTCATCCTCACGACGCTGGCGTCC
TGCAAGATGACAACTGTCGGCATCAAGTACTGGAACCTCATGGTCCGCCACTACGGCATCGTCCCGGACAGGGAT
AACTGGTACCGTATGCTGGGCATGACCAAGGTCTCCCGGAACAGCGCCTACGCGGCCGAGCTGCTGGAAATATTA
CCAGACGAATTCGTCTGCGGCAAGCCCTTCCAAATCGCCATGGCGGCATGCATACGAGACAGCGTCAACCCCAAC
GTCATGGCAAACGTCAACAAGGCCCTGGACATCATGTTGAGACGCCTCACTCTTCCAGATATGCTCGCGCTCCGC
CTCTACCTGCGCGTCGCCCTCGTCACTCACTCCAGCTTCCGCGGCGAGGCTATGCGCGGCCACTTAGCCTCGGGC
AAGCACCAGTACGGCGCCCAGATCGCGGCCGCCGTGGCCCGCGTGTGGGAGCCCTACAAGAAAAACTACTACCAC
TACTTCAAGGTCGAGCCCAAGCCACCAGGCCGCCGCGACGTCACCGACGAAATCTACAACAGCCAGCGCGAGGTC
ATGGCCCTCGCCCGCGGCATGTACAGGGCCATCGCTAAGCTTGACAACGAGGGCCTGCAGTCGAAGGAGGAGCTA
AAGGAGTTGCGCCGCCGAGGCGCGAAGATCAACCGCGAAATCCAGACCTTTTACGCCGATCGCGAGAAGCTGGAG
CCCAAGCTGAGGTCCAGCGCAGTTCGGTCAGGAGAGCCGGATCCTCACTCGTCCGAACTCAACACTGCCTTGCCC
CCTCTCAGCGATGACGAGGCCTTGTCCGACTTTGGCGACGAAGATCTGCTTCCCGGCGGCCTTGTGCCCGACGAA
GGGGACGACCGGGACCTCGTCCAGAAGTTTGAGTGGGAATGGGACACGACCAAACCAGTGGTAAGCCCACAGAAC
AAGAAATCGGCCAAGTTCAAAACGGTCAAGCCGTCATCACCGACCAGGGAGCCATTGGAAGCTACCATCTAG
Gene >Ophun1|5018
ATGGCGGCCGGTATCCTGCGCTTCTCCAGCGTCCTGCGCAAATTGGTCGTCGCCGAACTCAGCCCATCGTCTTAC
AGCGCGCTCTTGTTGAGAGGCCGAAGGCAGCCTTACTCGACTTTGTCGGATTCCGCCATCTACGACCTTATCACA
GAAAATGTGACTGAAGATGCGCCGAGTCGTCATAAGCGGATTCTCGAAGAAAATTCCCAGGATCAGACGCCGTCT
TTGGCCAGGCTACAACGCATCGTCCAGAGGCATCTCTCCCACATGCAAGATCCGTGGAAGATTGCTCAATATGTT
CAGGCGACGTTGGACAAGGACCGCTTCGACGAGGCTCTACTACTGGTGCAGACGGCTAGCAGAGACCGCGCAGTC
GAGGTGTCCTGGAACCTGCTCATCTCCTACCAGATCAAGAAAAAGCAGCTGAAGAGGGCAATTCAACTGTTCAAC
GAGGTGATGCTCCCTTTTCTCCAACTTCCGTGGCTAACTATGCACTAATATCCCATCTTACTATCTGTAGATGAA
AAAAAGAGGCCAGCTCCCCAACGTCAGCTCCTATACCATCCTCATCACCGGCTGCGCAGCTTCTGAGCACCCCAA
GCAAGCCGTTGCCGAGGCCGTCAAGCAGTATCAAGTCCTCCTCAGCAGCCCTCGCCTCAAGGCCAACACAATTCA
TCTCAACTGCGCGCTCAACGTCTGTGGCAGGGCCGGTGACCTCGAGTCTTTATTCATCGTTGCCGACTCCATCAA
CGACACGAGCCGCGCCCCTGACGCCGCGACATACTTAATCATACTAAACGCACTTCGCCAAGATGCCATGACCAA
GACGGAAGGCTTACCGTTTACGCAGCAAGAGGCCCTCAAGCAAAAGGCCATCGACCGCGGCAAGGGTATATGGCA
AGAGGTCATGAGCAAGTGGAAAGGGGGTCGGCTGAACATGGACGAGGGTCTCGCATGCGCCATGGGCCGTCTCCT
CCTCATCACTCCTCAGCGCAAGGAAAGGCCTCAAGTGCTGGATATTTTGCAACAGGCGTTGAACGTACCAAACCT
GACCAAGAAGCCGCTTGATGATACGGATCCTTTTGAAGATCCTGCCATGAAAGACATTGCTCTCCGCGAGACTTC
CTCCAAGACGAGGCAGGCCGTTCCCGGGCGAAACACGCTTGCACTCATCCTCACGACGCTGGCGTCCTGCAAGAT
GACAACTGTCGGCATCAAGTACTGGAACCTCATGGTCCGCCACTACGGCATCGTCCCGGACAGGGATAACTGGTA
CCGTATGCTGGGCATGACCAAGGTCTCCCGGAACAGCGCCTACGCGGCCGAGCTGCTGGAAATATTACCAGACGA
ATTCGTCTGCGGCAAGCCCTTCCAAATCGCCATGGCGGCATGCATACGAGACAGCGTCAACCCCAACGTCATGGC
AAACGTCAACAAGGCCCTGGACATCATGTTGAGACGCCTCACTCTTCCAGATATGCTCGCGCTCCGCCTCTACCT
GCGCGTCGCCCTCGTCACTCACTCCAGCTTCCGCGGCGAGGCTATGCGCGGCCACTTAGCCTCGGGCAAGCACCA
GTACGGCGCCCAGATCGCGGCCGCCGTGGCCCGCGTGTGGGAGCCCTACAAGAAAAACTACTACCACTACTTCAA
GGTCGAGCCCAAGCCACCAGGCCGCCGCGACGTCACCGACGAAATCTACAACAGCCAGCGCGAGGTCATGGCCCT
CGCCCGCGGCATGTACAGGGCCATCGCTAAGCTTGACAACGAGGGCCTGCAGTCGAAGGAGGAGCTAAAGGAGTT
GCGCCGCCGAGGCGCGAAGATCAACCGCGAAATCCAGACCTTTTACGCCGATCGCGAGAAGCTGGAGCCCAAGCT
GAGGTCCAGCGCAGTTCGGTCAGGAGAGCCGGATCCTCACTCGTCCGAACTCAACACTGCCTTGCCCCCTCTCAG
CGATGACGAGGCCTTGTCCGACTTTGGCGACGAAGATCTGCTTCCCGGCGGCCTTGTGCCCGACGAAGGGGACGA
CCGGGACCTCGTCCAGAAGTTTGAGTGGGAATGGGACACGACCAAACCAGTGGTAAGCCCACAGAACAAGAAATC
GGCCAAGTTCAAAACGGTCAAGCCGTCATCACCGACCAGGGAGCCATTGGAAGCTACCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail