Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5014
Gene name
LocationContig_479:12396..13985
Strand+
Gene length (bp)1589
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.9E-09 17 61
PF13445 zf-RING_UBOX RING-type zinc-finger 1.0E-08 17 59
PF13639 zf-RING_2 Ring finger domain 3.7E-07 16 62
PF14634 zf-RING_5 zinc-RING finger domain 1.1E-06 17 63
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.4E-06 17 61

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5WW08|CHFR_DANRE E3 ubiquitin-protein ligase CHFR OS=Danio rerio GN=chfr PE=2 SV=1 11 131 1.0E-12
sp|Q5FWP4|CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis GN=chfr PE=1 SV=1 2 112 1.0E-12
sp|Q6P256|CHFR_XENTR E3 ubiquitin-protein ligase CHFR OS=Xenopus tropicalis GN=chfr PE=2 SV=1 2 112 1.0E-12
sp|Q810L3|CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus GN=Chfr PE=1 SV=1 2 112 2.0E-12
sp|Q96EP1|CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens GN=CHFR PE=1 SV=2 3 112 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5WW08|CHFR_DANRE E3 ubiquitin-protein ligase CHFR OS=Danio rerio GN=chfr PE=2 SV=1 11 131 1.0E-12
sp|Q5FWP4|CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis GN=chfr PE=1 SV=1 2 112 1.0E-12
sp|Q6P256|CHFR_XENTR E3 ubiquitin-protein ligase CHFR OS=Xenopus tropicalis GN=chfr PE=2 SV=1 2 112 1.0E-12
sp|Q810L3|CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus GN=Chfr PE=1 SV=1 2 112 2.0E-12
sp|Q96EP1|CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens GN=CHFR PE=1 SV=2 3 112 5.0E-12
sp|Q5RF77|CHFR_PONAB E3 ubiquitin-protein ligase CHFR OS=Pongo abelii GN=CHFR PE=2 SV=1 3 112 5.0E-12
sp|Q8IYM9|TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens GN=TRIM22 PE=1 SV=1 1 75 6.0E-08
sp|Q99PQ1|TR12A_MOUSE Tripartite motif-containing protein 12A OS=Mus musculus GN=Trim12a PE=2 SV=1 10 81 1.0E-07
sp|Q1ACD8|TRIM5_PANPA Tripartite motif-containing protein 5 OS=Pan paniscus GN=TRIM5 PE=3 SV=1 9 78 2.0E-07
sp|Q2YEM9|TRIM5_PONPY Tripartite motif-containing protein 5 OS=Pongo pygmaeus GN=TRIM5 PE=2 SV=1 9 78 2.0E-07
sp|Q5D7J1|TRIM5_PANTR Tripartite motif-containing protein 5 OS=Pan troglodytes GN=TRIM5 PE=2 SV=1 9 78 2.0E-07
sp|Q9BZY9|TRI31_HUMAN E3 ubiquitin-protein ligase TRIM31 OS=Homo sapiens GN=TRIM31 PE=1 SV=2 11 129 2.0E-07
sp|Q5C8T8|TRIM5_PONAB Tripartite motif-containing protein 5 OS=Pongo abelii GN=TRIM5 PE=2 SV=1 9 78 3.0E-07
sp|Q9C035|TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens GN=TRIM5 PE=1 SV=1 9 78 3.0E-07
sp|Q5C8T6|TRIM5_GORGO Tripartite motif-containing protein 5 OS=Gorilla gorilla gorilla GN=TRIM5 PE=2 SV=1 9 78 3.0E-07
sp|Q3ZEE5|TRIM5_HYLLA Tripartite motif-containing protein 5 OS=Hylobates lar GN=TRIM5 PE=3 SV=1 9 78 4.0E-07
sp|Q2YEM8|TRIM5_HOOHO Tripartite motif-containing protein 5 OS=Hoolock hoolock GN=TRIM5 PE=3 SV=1 9 78 4.0E-07
sp|Q1ACD7|TRIM5_NOMLE Tripartite motif-containing protein 5 OS=Nomascus leucogenys GN=TRIM5 PE=3 SV=1 9 78 1.0E-06
sp|Q58D15|TRI54_BOVIN Tripartite motif-containing protein 54 OS=Bos taurus GN=TRIM54 PE=2 SV=1 10 80 1.0E-06
sp|Q9ERP3|TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus GN=Trim54 PE=1 SV=1 10 80 1.0E-06
sp|Q9BYV6|TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens GN=TRIM55 PE=1 SV=2 10 80 1.0E-06
sp|Q5REJ9|TRI54_PONAB Tripartite motif-containing protein 54 OS=Pongo abelii GN=TRIM54 PE=2 SV=1 10 80 1.0E-06
sp|Q5PQN5|TRI55_RAT Tripartite motif-containing protein 55 OS=Rattus norvegicus GN=Trim55 PE=1 SV=1 10 80 1.0E-06
sp|Q1ACD6|TRIM5_SYMSY Tripartite motif-containing protein 5 OS=Symphalangus syndactylus GN=TRIM5 PE=3 SV=1 9 78 1.0E-06
sp|Q9BYV2|TRI54_HUMAN Tripartite motif-containing protein 54 OS=Homo sapiens GN=TRIM54 PE=1 SV=3 10 80 1.0E-06
sp|Q5XIH6|TRI54_RAT Tripartite motif-containing protein 54 OS=Rattus norvegicus GN=Trim54 PE=2 SV=1 10 80 2.0E-06
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 4 70 2.0E-06
sp|Q8BH75|RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus GN=Rnf41 PE=1 SV=1 10 65 3.0E-06
sp|Q5R7T5|RNF41_PONAB E3 ubiquitin-protein ligase NRDP1 OS=Pongo abelii GN=RNF41 PE=2 SV=1 10 65 4.0E-06
sp|Q9H4P4|RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens GN=RNF41 PE=1 SV=2 10 65 4.0E-06
sp|Q5FWL3|RNF41_XENLA E3 ubiquitin-protein ligase NRDP1 OS=Xenopus laevis GN=rnf41 PE=2 SV=1 10 65 4.0E-06
sp|Q969Q1|TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens GN=TRIM63 PE=1 SV=1 7 80 6.0E-06
sp|Q5D7I1|TRIM5_ATEGE Tripartite motif-containing protein 5 OS=Ateles geoffroyi GN=TRIM5 PE=2 SV=1 3 74 7.0E-06
sp|Q9C030|TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens GN=TRIM6 PE=1 SV=1 9 213 7.0E-06
sp|Q91Z63|TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus GN=Trim63 PE=2 SV=1 10 80 9.0E-06
sp|Q38HM4|TRI63_MOUSE E3 ubiquitin-protein ligase TRIM63 OS=Mus musculus GN=Trim63 PE=1 SV=1 10 80 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5014
MDAARKPSLDLEKELTCSICTELLYQPLTLLDCLHTFCGACLTEWFSFQAATASRFTCPACRSAVRDSRHNATVV
TLLDMLVAAHPSKARSDEDKKEMARKYRPGDQVPPKTPSAGTRTEDDGRLLSRVRDMSLRDGLRPPSSRRRHEGQ
SRSVGRDRSSENRSRRGNDDDDDGHDSDGRRRSTELRLRRDESGDRQVEHQSSLRSLIGSADRGERDIEREIDEF
ARQIQEEGLLDGLDLDNIDLSRDDELSRRVTEAYRRRQRRGRSRRQDGHGAASTSSSVNGDGRSSRPPPAGLDTG
RSRRRTASGGGSSVAAAALSVGEATRPAARSQTELIPGRGNGPGPGEQRRSSSTPSVPASSPSISGENTNHASFA
IRAPQWNPETNRPSEPAIVNPPRNRPQLYPEPSIGCSRCGKTHIEYEVHYSCGICAGGQWTICLGCYRAGKGCLH
WFGFGHSAWNKWDKAQQLEPTTAPPHDEA*
Coding >Ophun1|5014
ATGGATGCTGCTCGCAAGCCCAGCCTGGACCTGGAAAAGGAACTGACATGCTCGATCTGCACCGAGCTGCTCTAC
CAGCCGCTGACGCTGCTCGACTGCCTGCACACGTTTTGCGGCGCCTGTCTGACGGAGTGGTTCTCCTTTCAGGCG
GCGACGGCGTCTCGCTTCACCTGTCCAGCCTGCCGCAGCGCGGTGCGAGACAGCCGCCATAATGCAACCGTCGTG
ACGCTCCTCGATATGCTGGTGGCAGCGCATCCGTCCAAGGCGCGGTCGGACGAGGACAAGAAGGAGATGGCCCGC
AAGTATCGCCCGGGCGATCAGGTGCCGCCCAAGACACCATCAGCCGGGACGCGGACGGAAGACGACGGCCGGCTG
CTGAGCCGCGTCCGGGACATGAGTCTACGGGATGGTCTTCGGCCGCCGTCTTCTCGGAGGCGTCATGAGGGTCAG
AGTCGGTCTGTTGGTCGAGACCGGAGCTCTGAGAATCGCTCGCGGCGCGGCAACGACGACGACGATGACGGTCAT
GACTCTGATGGCCGGCGACGGAGCACGGAGCTGCGGCTGCGACGGGACGAATCTGGCGATCGTCAAGTTGAGCAT
CAGTCTTCGCTGAGGTCTCTCATCGGCTCGGCAGACAGGGGCGAACGCGATATCGAGAGAGAGATTGACGAGTTT
GCGCGCCAGATTCAAGAAGAAGGTCTCCTCGACGGCCTCGATCTCGATAACATCGACCTCAGCCGCGACGATGAG
CTGAGCCGGCGCGTAACCGAGGCCTATCGTCGTCGGCAGAGGAGAGGTCGTTCTCGCCGGCAAGACGGACATGGT
GCTGCGTCTACGTCGTCATCGGTCAACGGAGATGGTCGAAGCAGCAGGCCGCCGCCCGCCGGCCTCGACACCGGT
CGCTCTCGGAGGAGGACGGCCAGCGGCGGCGGTAGTAGCGTTGCGGCGGCGGCCCTCTCAGTCGGCGAGGCGACG
AGACCGGCTGCCCGGTCACAAACGGAGCTCATCCCGGGCCGCGGAAACGGGCCAGGACCGGGTGAGCAGCGACGC
AGCTCAAGCACGCCTTCAGTCCCGGCATCATCACCGTCGATATCCGGCGAAAACACAAACCACGCATCCTTCGCC
ATCCGCGCGCCGCAGTGGAACCCAGAGACGAACCGTCCGTCCGAGCCAGCCATCGTCAACCCCCCACGCAACCGA
CCACAGCTCTACCCCGAACCCTCCATCGGCTGCTCCCGCTGCGGCAAGACACACATCGAGTACGAAGTGCACTAC
AGCTGCGGCATCTGCGCCGGCGGACAATGGACCATCTGTCTCGGCTGCTACCGCGCAGGCAAGGGCTGTCTTCAC
TGGTTCGGCTTCGGCCACAGCGCATGGAATAAATGGGATAAGGCGCAGCAGCTGGAGCCGACGACGGCGCCGCCG
CACGACGAGGCTTGA
Transcript >Ophun1|5014
ATGGATGCTGCTCGCAAGCCCAGCCTGGACCTGGAAAAGGAACTGACATGCTCGATCTGCACCGAGCTGCTCTAC
CAGCCGCTGACGCTGCTCGACTGCCTGCACACGTTTTGCGGCGCCTGTCTGACGGAGTGGTTCTCCTTTCAGGCG
GCGACGGCGTCTCGCTTCACCTGTCCAGCCTGCCGCAGCGCGGTGCGAGACAGCCGCCATAATGCAACCGTCGTG
ACGCTCCTCGATATGCTGGTGGCAGCGCATCCGTCCAAGGCGCGGTCGGACGAGGACAAGAAGGAGATGGCCCGC
AAGTATCGCCCGGGCGATCAGGTGCCGCCCAAGACACCATCAGCCGGGACGCGGACGGAAGACGACGGCCGGCTG
CTGAGCCGCGTCCGGGACATGAGTCTACGGGATGGTCTTCGGCCGCCGTCTTCTCGGAGGCGTCATGAGGGTCAG
AGTCGGTCTGTTGGTCGAGACCGGAGCTCTGAGAATCGCTCGCGGCGCGGCAACGACGACGACGATGACGGTCAT
GACTCTGATGGCCGGCGACGGAGCACGGAGCTGCGGCTGCGACGGGACGAATCTGGCGATCGTCAAGTTGAGCAT
CAGTCTTCGCTGAGGTCTCTCATCGGCTCGGCAGACAGGGGCGAACGCGATATCGAGAGAGAGATTGACGAGTTT
GCGCGCCAGATTCAAGAAGAAGGTCTCCTCGACGGCCTCGATCTCGATAACATCGACCTCAGCCGCGACGATGAG
CTGAGCCGGCGCGTAACCGAGGCCTATCGTCGTCGGCAGAGGAGAGGTCGTTCTCGCCGGCAAGACGGACATGGT
GCTGCGTCTACGTCGTCATCGGTCAACGGAGATGGTCGAAGCAGCAGGCCGCCGCCCGCCGGCCTCGACACCGGT
CGCTCTCGGAGGAGGACGGCCAGCGGCGGCGGTAGTAGCGTTGCGGCGGCGGCCCTCTCAGTCGGCGAGGCGACG
AGACCGGCTGCCCGGTCACAAACGGAGCTCATCCCGGGCCGCGGAAACGGGCCAGGACCGGGTGAGCAGCGACGC
AGCTCAAGCACGCCTTCAGTCCCGGCATCATCACCGTCGATATCCGGCGAAAACACAAACCACGCATCCTTCGCC
ATCCGCGCGCCGCAGTGGAACCCAGAGACGAACCGTCCGTCCGAGCCAGCCATCGTCAACCCCCCACGCAACCGA
CCACAGCTCTACCCCGAACCCTCCATCGGCTGCTCCCGCTGCGGCAAGACACACATCGAGTACGAAGTGCACTAC
AGCTGCGGCATCTGCGCCGGCGGACAATGGACCATCTGTCTCGGCTGCTACCGCGCAGGCAAGGGCTGTCTTCAC
TGGTTCGGCTTCGGCCACAGCGCATGGAATAAATGGGATAAGGCGCAGCAGCTGGAGCCGACGACGGCGCCGCCG
CACGACGAGGCTTGA
Gene >Ophun1|5014
ATGGATGCTGCTCGCAAGCCCAGCCTGGACCTGGAAAAGGAACTGACATGCTCGGTCAGTGGAAAAGCCTCGTCT
GTCGCTCCTCGACGGACTCCCAACTGACGGAGCGCTGCCCAGATCTGCACCGAGCTGCTCTACCAGCCGCTGACG
CTGCTCGACTGCCTGCACACGTTTTGCGGCGCCTGTCTGACGGAGTGGTTCTCCTTTCAGGCGGCGACGGCGTCT
CGCTTCACCTGTCCAGCCTGCCGCAGCGCGGTGCGAGACAGCCGCCATAATGCAACCGTCGTGACGCTCCTCGAT
ATGCTGGTGGCAGCGCATCCGTCCAAGGCGCGGTCGGACGAGGACAAGAAGGAGATGGCCCGCAAGTATCGCCCG
GGCGATCAGGTGCCGCCCAAGACACCATCAGCCGGGACGCGGACGGAAGACGACGGCCGGCTGCTGAGCCGCGTC
CGGGACATGAGTCTACGGGATGGTCTTCGGCCGCCGTCTTCTCGGAGGCGTCATGAGGGTCAGAGTCGGTCTGTT
GGTCGAGACCGGAGCTCTGAGAATCGCTCGCGGCGCGGCAACGACGACGACGATGACGGTCATGACTCTGATGGC
CGGCGACGGAGCACGGAGCTGCGGCTGCGACGGGACGAATCTGGCGATCGTCAAGTTGAGCATCAGTCTTCGCTG
AGGTCTCTCATCGGCTCGGCAGACAGGGGCGAACGCGATATCGAGAGAGAGATTGACGAGTTTGCGCGCCAGATT
CAAGAAGAAGGTCTCCTCGACGGCCTCGATCTCGATAACATCGACCTCAGCCGCGACGATGAGCTGAGCCGGCGC
GTAACCGAGGCCTATCGTCGTCGGCAGAGGAGAGGTCGTTCTCGCCGGCAAGACGGACATGGTGCTGCGTCTACG
TCGTCATCGGTCAACGGAGATGGTCGAAGCAGCAGGCCGCCGCCCGCCGGCCTCGACACCGGTCGCTCTCGGAGG
AGGACGGCCAGCGGCGGCGGTAGTAGCGTTGCGGCGGCGGCCCTCTCAGTCGGCGAGGCGACGAGACCGGCTGCC
CGGTCACAAACGGAGCTCATCCCGGGCCGCGGAAACGGGCCAGGACCGGGTGAGCAGCGACGCAGCTCAAGCACG
CCTTCAGTCCCGGCATCATCACCGTCGATATCCGGCGAAAACACAAACCACGCATCCTTCGCCATCCGCGCGCCG
CAGTGGAACCCAGAGACGAACCGTCCGTCCGAGCCAGCCATCGTCAACCCCCCACGCAACCGACCACAGCTCTAC
CCCGAACCCTCCATCGGCTGCTCCCGCTGCGGCAAGACACACATCGAGTACGAAGTGCACTACAGCTGCGGCATC
TGCGCCGGCGGACAATGGACCATCTGTCTCGGCTGCTACCGCGCAGGCAAGGGCTGTCTTCACTGGTTCGGCTTC
GGCCACAGCGCATGGAATAAATGGGATAAGGCGCAGCAGCTGGAGCCGACGACGGCGCCGCCGCACGTACTGACG
CCGAGCCGGTACCTGCGGCCTGCGTCGGTGCCCGGCGGTGCGGACGGTCGACGGACGCTGACGTGGCATGATCCC
AGGACGAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail