Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5008
Gene name
LocationContig_478:11775..13807
Strand+
Gene length (bp)2032
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 3.9E-08 143 211

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 44 0.527464

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6887
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03537
Ophiocordyceps camponoti-rufipedis Ophun1|3638
Ophiocordyceps camponoti-rufipedis Ophun1|5008 (this protein)
Ophiocordyceps kimflemingae Ophio5|8387

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5008
MASSGLIQEKLDDPQAQKKMKASTKMHAAVLLATWLFSWNVAAASNHFFDGSLADDTFSDNIGPINVTLFIAWPV
LGMVDGVRQNSHLYFRRRGGIGDYITDDLDNNHRTDASWGYISSLPEARGPWIHLNRSLSTTVRDLDAGHQDYII
FAVAASPNMVTLEEDPSRREATHAALGGIQWTQIRAWTYLSWDQWRYPASFEWQMNREFNRSWERLGPSGPQPAL
RGPPSPGRLAEASPVHGPLYEAVAWSFMGFLTEPGTELRNLFAELVDWDLEFEPWRNFPLLRRGILQDEVSRPAT
AASSPNPLPESPPEPESLQTIVLRQLDWANLDVPLFIRHAMLASAALTPQLCDAALRSARSYYGHQRRAAVLPPS
YDVFLGNVPVAPDTCHTLYRVFQSRCDSVSALHVDFSIGTAWLWGAGTNDAVGLLLGPPSVIPLLKAPSGGDEIK
NMSINLKTVFGAEIVPLRDIKVMQLLDTPLDSYWGPDWWKFGGITLTATCASSAQKLELADYNQVNQAVLNEVPA
PYGPQVVWSRDIDIEHWKPKK*
Coding >Ophun1|5008
ATGGCCTCATCTGGCCTCATCCAAGAGAAGCTTGACGATCCCCAAGCTCAGAAGAAGATGAAGGCGAGCACCAAG
ATGCATGCCGCCGTGCTGCTGGCCACATGGCTATTCTCCTGGAACGTCGCCGCCGCCTCCAATCATTTCTTCGAT
GGTTCATTAGCAGATGATACGTTCTCTGACAACATAGGACCCATAAATGTCACCCTCTTCATCGCCTGGCCCGTG
CTCGGCATGGTGGATGGCGTGAGGCAGAATTCGCATCTGTACTTCAGGCGTCGGGGCGGGATAGGCGACTACATC
ACCGACGACCTTGATAACAATCATCGCACCGACGCATCATGGGGATACATTTCGAGCTTGCCCGAAGCACGTGGT
CCCTGGATCCATCTCAACCGCTCTCTCTCCACTACTGTCCGAGATCTCGATGCGGGCCATCAAGACTACATCATC
TTCGCCGTCGCCGCATCACCCAACATGGTCACCCTGGAAGAGGACCCAAGCCGACGCGAAGCCACGCACGCCGCG
CTGGGAGGCATACAATGGACACAAATCCGCGCATGGACCTATCTAAGCTGGGACCAGTGGCGATATCCCGCCTCG
TTCGAGTGGCAGATGAACCGCGAATTCAACCGCTCATGGGAGAGACTTGGGCCCAGCGGTCCGCAGCCCGCGCTC
AGAGGTCCCCCTTCACCTGGGCGACTGGCGGAAGCGTCACCGGTTCACGGGCCTTTGTACGAGGCCGTTGCCTGG
AGCTTCATGGGTTTCCTCACAGAACCTGGCACCGAGCTGCGAAACCTATTCGCAGAACTGGTTGATTGGGACCTC
GAATTCGAACCATGGCGAAACTTCCCCCTGCTCCGACGAGGAATCCTCCAGGACGAAGTCTCACGCCCAGCAACA
GCAGCATCATCCCCCAACCCCCTCCCCGAATCCCCCCCAGAACCGGAATCCCTCCAAACCATCGTCCTCCGCCAA
CTGGACTGGGCCAACCTCGACGTCCCCCTCTTCATCCGCCACGCCATGCTCGCCTCCGCAGCCCTCACCCCCCAA
CTCTGCGACGCCGCCCTCCGCTCCGCCCGATCCTACTACGGCCACCAGCGCCGCGCCGCAGTCCTGCCCCCGAGC
TACGACGTCTTCTTGGGCAACGTCCCCGTCGCCCCCGATACCTGCCATACCCTCTACCGCGTCTTCCAGAGCAGA
TGCGATTCCGTCTCCGCTCTGCACGTCGACTTCTCCATCGGCACCGCCTGGCTTTGGGGCGCGGGTACCAACGAT
GCCGTCGGTCTACTCCTCGGCCCCCCCTCCGTCATCCCCCTCCTCAAAGCCCCATCCGGAGGCGACGAAATCAAA
AACATGTCCATCAACCTCAAGACCGTCTTCGGCGCAGAGATTGTCCCGCTGCGAGACATAAAGGTCATGCAACTC
CTCGACACGCCTCTGGATAGCTACTGGGGTCCCGACTGGTGGAAGTTTGGCGGCATCACCCTGACAGCAACTTGC
GCCAGCAGCGCCCAAAAACTCGAGCTGGCTGATTACAATCAAGTCAACCAGGCTGTTCTGAACGAAGTCCCGGCG
CCGTACGGACCGCAGGTTGTGTGGTCTCGTGACATTGACATCGAGCACTGGAAGCCCAAGAAGTGA
Transcript >Ophun1|5008
ATGGCCTCATCTGGCCTCATCCAAGAGAAGCTTGACGATCCCCAAGCTCAGAAGAAGATGAAGGCGAGCACCAAG
ATGCATGCCGCCGTGCTGCTGGCCACATGGCTATTCTCCTGGAACGTCGCCGCCGCCTCCAATCATTTCTTCGAT
GGTTCATTAGCAGATGATACGTTCTCTGACAACATAGGACCCATAAATGTCACCCTCTTCATCGCCTGGCCCGTG
CTCGGCATGGTGGATGGCGTGAGGCAGAATTCGCATCTGTACTTCAGGCGTCGGGGCGGGATAGGCGACTACATC
ACCGACGACCTTGATAACAATCATCGCACCGACGCATCATGGGGATACATTTCGAGCTTGCCCGAAGCACGTGGT
CCCTGGATCCATCTCAACCGCTCTCTCTCCACTACTGTCCGAGATCTCGATGCGGGCCATCAAGACTACATCATC
TTCGCCGTCGCCGCATCACCCAACATGGTCACCCTGGAAGAGGACCCAAGCCGACGCGAAGCCACGCACGCCGCG
CTGGGAGGCATACAATGGACACAAATCCGCGCATGGACCTATCTAAGCTGGGACCAGTGGCGATATCCCGCCTCG
TTCGAGTGGCAGATGAACCGCGAATTCAACCGCTCATGGGAGAGACTTGGGCCCAGCGGTCCGCAGCCCGCGCTC
AGAGGTCCCCCTTCACCTGGGCGACTGGCGGAAGCGTCACCGGTTCACGGGCCTTTGTACGAGGCCGTTGCCTGG
AGCTTCATGGGTTTCCTCACAGAACCTGGCACCGAGCTGCGAAACCTATTCGCAGAACTGGTTGATTGGGACCTC
GAATTCGAACCATGGCGAAACTTCCCCCTGCTCCGACGAGGAATCCTCCAGGACGAAGTCTCACGCCCAGCAACA
GCAGCATCATCCCCCAACCCCCTCCCCGAATCCCCCCCAGAACCGGAATCCCTCCAAACCATCGTCCTCCGCCAA
CTGGACTGGGCCAACCTCGACGTCCCCCTCTTCATCCGCCACGCCATGCTCGCCTCCGCAGCCCTCACCCCCCAA
CTCTGCGACGCCGCCCTCCGCTCCGCCCGATCCTACTACGGCCACCAGCGCCGCGCCGCAGTCCTGCCCCCGAGC
TACGACGTCTTCTTGGGCAACGTCCCCGTCGCCCCCGATACCTGCCATACCCTCTACCGCGTCTTCCAGAGCAGA
TGCGATTCCGTCTCCGCTCTGCACGTCGACTTCTCCATCGGCACCGCCTGGCTTTGGGGCGCGGGTACCAACGAT
GCCGTCGGTCTACTCCTCGGCCCCCCCTCCGTCATCCCCCTCCTCAAAGCCCCATCCGGAGGCGACGAAATCAAA
AACATGTCCATCAACCTCAAGACCGTCTTCGGCGCAGAGATTGTCCCGCTGCGAGACATAAAGGTCATGCAACTC
CTCGACACGCCTCTGGATAGCTACTGGGGTCCCGACTGGTGGAAGTTTGGCGGCATCACCCTGACAGCAACTTGC
GCCAGCAGCGCCCAAAAACTCGAGCTGGCTGATTACAATCAAGTCAACCAGGCTGTTCTGAACGAAGTCCCGGCG
CCGTACGGACCGCAGGTTGTGTGGTCTCGTGACATTGACATCGAGCACTGGAAGCCCAAGAAGTGA
Gene >Ophun1|5008
ATGGCCTCATCTGGCCTCATCCAAGAGAAGCTTGACGATCCCCAAGCTCAGGTCCGAAACCTTGTTGCTGCTGTG
CCGCCTTCAGACGGGAGCCATGTGGTCGGCAGTCGAGTCGGAAGGGTGCCAAGATGAGGAGCGAGTCGGGCCCCT
GCTTGCGAGGCCCGAAAACGAATAGTCGGATGAATGGTCATGACGGGACGTCGTGATATTACGCTTCGGCCCTTG
CCAAGACGAGGTCGAGATATTTGCCAAGCTTCCATATGTTTTCGCTTCTTCGTGTCGTGGACTTGCTTCTTCACC
ATTCTCACCTTGGACTCATCAGCCCGGGGTATAAAGCCCTCCGGTGAGGATCTCTTCTCCAACACGAAACTGCTG
TATACTGACAATTCACAGCAGAAGAAGATGAAGGCGAGCACCAAGATGCATGCCGCCGTGCTGCTGGCCACATGG
CTATTCTCCTGGAACGTCGCCGCCGCCTCCAATCATTTCTTCGATGGTTCATTAGCAGATGATACGTTCTCTGAC
AACATAGGACCCATAAATGTCACCCTCTTCATCGCCTGGCCCGTGCTCGGCATGGTGGATGGCGTGAGGCAGAAT
TCGCATCTGTACTTCAGGCGTCGGGGCGGGATAGGCGACTACATCACCGACGACCTTGATAACAATCATCGCACC
GACGCATCATGGGGATACATTTCGAGCTTGCCCGAAGCACGTGGTCCCTGGATCCATCTCAACCGCTCTCTCTCC
ACTACTGTCCGAGATCTCGATGCGGGCCATCAAGACTACATCATCTTCGCCGTCGCCGCATCACCCAACATGGTC
ACCCTGGAAGAGGACCCAAGCCGACGCGAAGCCACGCACGCCGCGCTGGGAGGCATACAATGGACACAAATCCGC
GCATGGACCTATCTAAGCTGGGACCAGTGGCGATATCCCGCCTCGTTCGAGTGGCAGATGAACCGCGAATTCAAC
CGCTCATGGGAGAGACTTGGGCCCAGCGGTCCGCAGCCCGCGCTCAGAGGTCCCCCTTCACCTGGGCGACTGGCG
GAAGCGTCACCGGTTCACGGGCCTTTGTACGAGGCCGTTGCCTGGAGCTTCATGGGTTTCCTCACAGAACCTGGC
ACCGAGCTGCGAAACCTATTCGCAGAACTGGTTGATTGGGACCTCGAATTCGAACCATGGCGAAACTTCCCCCTG
CTCCGACGAGGAATCCTCCAGGACGAAGTCTCACGCCCAGCAACAGCAGCATCATCCCCCAACCCCCTCCCCGAA
TCCCCCCCAGAACCGGAATCCCTCCAAACCATCGTCCTCCGCCAACTGGACTGGGCCAACCTCGACGTCCCCCTC
TTCATCCGCCACGCCATGCTCGCCTCCGCAGCCCTCACCCCCCAACTCTGCGACGCCGCCCTCCGCTCCGCCCGA
TCCTACTACGGCCACCAGCGCCGCGCCGCAGTCCTGCCCCCGAGCTACGACGTCTTCTTGGGCAACGTCCCCGTC
GCCCCCGATACCTGCCATACCCTCTACCGCGTCTTCCAGAGCAGATGCGATTCCGTCTCCGCTCTGCACGTCGAC
TTCTCCATCGGCACCGCCTGGCTTTGGGGCGCGGGTACCAACGATGCCGTCGGTCTACTCCTCGGCCCCCCCTCC
GTCATCCCCCTCCTCAAAGCCCCATCCGGAGGCGACGAAATCAAAAACATGTCCATCAACCTCAAGACCGTCTTC
GGCGCAGAGATTGTCCCGCTGCGAGACATAAAGGTCATGCAACTCCTCGACACGCCTCTGGATAGCTACTGGGGT
CCCGACTGGTGGAAGTTTGGCGGTGAGTTCCCCCCTTTCCGCTTCTCCCCCCAGCTAACGAGATCAAGGCATCAC
CCTGACAGCAACTTGCGCCAGCAGCGCCCAAAAACTCGAGCTGGCTGATTACAATCAAGTCAACCAGGCTGTTCT
GAACGAAGTCCCGGCGCCGTACGGACCGCAGGTTGTGTGGTCTCGTGACATTGACATCGAGCACTGGAAGCCCAA
GAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail