Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4992
Gene name
LocationContig_476:2165..4007
Strand-
Gene length (bp)1842
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04129 Vps52 Vps52 / Sac2 family 1.4E-120 65 567

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FVV6|VP52B_ARATH Vacuolar protein sorting-associated protein 52 B OS=Arabidopsis thaliana GN=P2 PE=2 SV=1 63 564 1.0E-73
sp|Q94KD3|VP52A_ARATH Vacuolar protein sorting-associated protein 52 A OS=Arabidopsis thaliana GN=VPS52 PE=1 SV=1 66 564 2.0E-72
sp|Q9UST3|VPS52_SCHPO Vacuolar protein sorting-associated protein 52 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps52 PE=3 SV=1 69 564 1.0E-71
sp|P39904|VPS52_YEAST Vacuolar protein sorting-associated protein 52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS52 PE=1 SV=2 69 538 1.0E-65
sp|Q8C754|VPS52_MOUSE Vacuolar protein sorting-associated protein 52 homolog OS=Mus musculus GN=Vps52 PE=1 SV=1 66 546 7.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FVV6|VP52B_ARATH Vacuolar protein sorting-associated protein 52 B OS=Arabidopsis thaliana GN=P2 PE=2 SV=1 63 564 1.0E-73
sp|Q94KD3|VP52A_ARATH Vacuolar protein sorting-associated protein 52 A OS=Arabidopsis thaliana GN=VPS52 PE=1 SV=1 66 564 2.0E-72
sp|Q9UST3|VPS52_SCHPO Vacuolar protein sorting-associated protein 52 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps52 PE=3 SV=1 69 564 1.0E-71
sp|P39904|VPS52_YEAST Vacuolar protein sorting-associated protein 52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS52 PE=1 SV=2 69 538 1.0E-65
sp|Q8C754|VPS52_MOUSE Vacuolar protein sorting-associated protein 52 homolog OS=Mus musculus GN=Vps52 PE=1 SV=1 66 546 7.0E-60
sp|Q8N1B4|VPS52_HUMAN Vacuolar protein sorting-associated protein 52 homolog OS=Homo sapiens GN=VPS52 PE=1 SV=1 67 546 1.0E-59
sp|Q5TJF0|VPS52_CANLF Vacuolar protein sorting-associated protein 52 homolog OS=Canis lupus familiaris GN=VPS52 PE=3 SV=1 67 546 2.0E-59
sp|O55166|VPS52_RAT Vacuolar protein sorting-associated protein 52 homolog OS=Rattus norvegicus GN=Vps52 PE=2 SV=2 67 546 3.0E-59
sp|G5EFV8|VPS52_CAEEL Vacuolar protein sorting-associated protein 52 homolog OS=Caenorhabditis elegans GN=vps-52 PE=1 SV=2 53 552 3.0E-51
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5244
Ophiocordyceps australis map64 (Brazil) OphauB2|7326
Ophiocordyceps camponoti-floridani Ophcf2|04240
Ophiocordyceps camponoti-rufipedis Ophun1|4992 (this protein)
Ophiocordyceps kimflemingae Ophio5|2410
Ophiocordyceps subramaniannii Hirsu2|4189

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4992
MDALEKLLSAGKDGSQPAPLIERDLDFNPDFGGLSLKELVEEADQGTPRRLLAVEECEADKFKFDGLHNSIVACD
DILKSVETNLASFRNDLAAVSADIETLQSRSGALNQRLENRNEVERALGPLVEELSVPPDIVSKISEGAIDDQWL
KALSEVDRRAAAQEKNTAPGSGHLKAFEELGPLLEKLTLRAIERIRDYLVTQIKALRSPHIDAQIIQQQKFLKFK
DLFSFLHRHHATLAQEISLAYMNTMRWYYINQFSRYEKALAKIKLHALDKNDTLGHEDATRMAAMLSTSRVAGPH
HDAFNLGRRITLLKAKNQPALSSYLAEEDQSTHYLEVPFRNFNLALVDNATAEYTFLASFFHPALSLSQVSKNFN
YIFEPTFELGRTLSKSLVGETYDALGVLMCIRLNQQFAFELQRRKVPAVDGYVNATNMLLWPRLQVVMDRHCESV
RQLTSSLPARPSRSGADQSRATAAPHVVTQRFGQILHGFLALSAEAGDDEPVVASLQRLRSDVEAFLTRQSQLYG
NEKRKNNRFLYNNFSLILTIMGDTDGRLAAEQRNHFEQLKAAHEDGSS*
Coding >Ophun1|4992
ATGGATGCGTTGGAGAAGCTACTCAGCGCAGGCAAGGATGGCTCACAGCCTGCCCCCTTGATCGAGCGAGACCTC
GATTTTAATCCGGACTTTGGTGGTCTATCTCTCAAAGAACTTGTGGAAGAGGCTGATCAAGGCACTCCCCGGCGC
CTGCTTGCGGTTGAGGAATGCGAAGCAGACAAGTTCAAGTTCGACGGACTCCACAACTCAATTGTCGCCTGCGAC
GACATATTGAAATCTGTGGAGACAAACTTGGCCAGCTTTCGCAACGATCTCGCCGCAGTCTCTGCCGACATCGAG
ACCCTGCAATCCCGATCGGGTGCCTTGAATCAGCGGCTAGAAAACCGCAATGAAGTAGAAAGAGCACTTGGACCG
CTGGTGGAGGAGCTCAGTGTCCCGCCCGACATCGTATCCAAGATATCTGAGGGCGCCATTGATGACCAGTGGCTC
AAGGCCTTGTCCGAAGTGGACAGGAGAGCTGCCGCGCAAGAGAAGAATACGGCGCCTGGATCCGGCCATCTCAAA
GCATTCGAAGAGCTCGGCCCATTGCTGGAGAAGCTTACCTTGAGAGCCATTGAGCGCATTCGCGATTATCTCGTC
ACCCAGATCAAGGCGCTCCGATCTCCCCACATCGATGCTCAGATAATACAGCAGCAAAAGTTTCTAAAGTTCAAG
GATCTGTTTTCTTTCCTGCACAGACACCACGCGACGCTCGCCCAAGAGATATCACTGGCGTACATGAACACAATG
CGATGGTATTATATCAACCAGTTCAGTCGCTACGAGAAAGCCCTGGCCAAAATCAAACTACACGCACTGGACAAA
AATGACACGCTGGGTCACGAGGACGCAACGCGGATGGCGGCTATGCTTTCGACTTCGCGTGTCGCGGGCCCTCAT
CACGACGCGTTCAATTTGGGACGTCGGATAACCCTTCTGAAAGCCAAGAATCAGCCCGCCTTGTCCTCATATCTG
GCCGAGGAAGACCAGTCAACACACTACCTCGAGGTCCCGTTCCGCAACTTCAACCTCGCCTTGGTCGATAACGCA
ACTGCCGAGTATACCTTCCTGGCGTCCTTCTTTCACCCGGCTCTGTCTCTTTCCCAGGTGTCGAAGAACTTCAAC
TACATCTTCGAGCCAACCTTTGAACTTGGTCGGACACTGTCCAAGTCACTTGTTGGAGAGACGTATGATGCTCTT
GGTGTTCTCATGTGTATCCGCCTCAACCAGCAGTTTGCATTCGAGCTACAGCGACGAAAGGTTCCAGCCGTGGAC
GGCTACGTCAACGCAACCAACATGCTTCTGTGGCCTCGGCTCCAGGTCGTCATGGACCGTCACTGCGAATCCGTG
AGGCAGCTAACGAGTTCTCTACCCGCACGGCCCTCTCGGTCCGGAGCAGACCAGTCGAGGGCGACGGCCGCGCCA
CACGTCGTGACTCAGCGGTTTGGACAGATCCTCCACGGCTTTCTGGCCCTCAGTGCTGAGGCTGGGGACGACGAG
CCGGTCGTTGCGAGCCTGCAGCGGTTGCGCTCCGACGTCGAGGCTTTTCTGACGCGACAAAGCCAGCTGTACGGC
AACGAAAAGCGCAAGAACAACCGGTTCCTCTACAACAACTTTTCTCTGATTCTCACCATCATGGGTGACACTGAT
GGAAGGCTGGCCGCGGAACAGCGAAACCATTTCGAACAGCTCAAGGCAGCTCACGAGGACGGATCATCATGA
Transcript >Ophun1|4992
ATGGATGCGTTGGAGAAGCTACTCAGCGCAGGCAAGGATGGCTCACAGCCTGCCCCCTTGATCGAGCGAGACCTC
GATTTTAATCCGGACTTTGGTGGTCTATCTCTCAAAGAACTTGTGGAAGAGGCTGATCAAGGCACTCCCCGGCGC
CTGCTTGCGGTTGAGGAATGCGAAGCAGACAAGTTCAAGTTCGACGGACTCCACAACTCAATTGTCGCCTGCGAC
GACATATTGAAATCTGTGGAGACAAACTTGGCCAGCTTTCGCAACGATCTCGCCGCAGTCTCTGCCGACATCGAG
ACCCTGCAATCCCGATCGGGTGCCTTGAATCAGCGGCTAGAAAACCGCAATGAAGTAGAAAGAGCACTTGGACCG
CTGGTGGAGGAGCTCAGTGTCCCGCCCGACATCGTATCCAAGATATCTGAGGGCGCCATTGATGACCAGTGGCTC
AAGGCCTTGTCCGAAGTGGACAGGAGAGCTGCCGCGCAAGAGAAGAATACGGCGCCTGGATCCGGCCATCTCAAA
GCATTCGAAGAGCTCGGCCCATTGCTGGAGAAGCTTACCTTGAGAGCCATTGAGCGCATTCGCGATTATCTCGTC
ACCCAGATCAAGGCGCTCCGATCTCCCCACATCGATGCTCAGATAATACAGCAGCAAAAGTTTCTAAAGTTCAAG
GATCTGTTTTCTTTCCTGCACAGACACCACGCGACGCTCGCCCAAGAGATATCACTGGCGTACATGAACACAATG
CGATGGTATTATATCAACCAGTTCAGTCGCTACGAGAAAGCCCTGGCCAAAATCAAACTACACGCACTGGACAAA
AATGACACGCTGGGTCACGAGGACGCAACGCGGATGGCGGCTATGCTTTCGACTTCGCGTGTCGCGGGCCCTCAT
CACGACGCGTTCAATTTGGGACGTCGGATAACCCTTCTGAAAGCCAAGAATCAGCCCGCCTTGTCCTCATATCTG
GCCGAGGAAGACCAGTCAACACACTACCTCGAGGTCCCGTTCCGCAACTTCAACCTCGCCTTGGTCGATAACGCA
ACTGCCGAGTATACCTTCCTGGCGTCCTTCTTTCACCCGGCTCTGTCTCTTTCCCAGGTGTCGAAGAACTTCAAC
TACATCTTCGAGCCAACCTTTGAACTTGGTCGGACACTGTCCAAGTCACTTGTTGGAGAGACGTATGATGCTCTT
GGTGTTCTCATGTGTATCCGCCTCAACCAGCAGTTTGCATTCGAGCTACAGCGACGAAAGGTTCCAGCCGTGGAC
GGCTACGTCAACGCAACCAACATGCTTCTGTGGCCTCGGCTCCAGGTCGTCATGGACCGTCACTGCGAATCCGTG
AGGCAGCTAACGAGTTCTCTACCCGCACGGCCCTCTCGGTCCGGAGCAGACCAGTCGAGGGCGACGGCCGCGCCA
CACGTCGTGACTCAGCGGTTTGGACAGATCCTCCACGGCTTTCTGGCCCTCAGTGCTGAGGCTGGGGACGACGAG
CCGGTCGTTGCGAGCCTGCAGCGGTTGCGCTCCGACGTCGAGGCTTTTCTGACGCGACAAAGCCAGCTGTACGGC
AACGAAAAGCGCAAGAACAACCGGTTCCTCTACAACAACTTTTCTCTGATTCTCACCATCATGGGTGACACTGAT
GGAAGGCTGGCCGCGGAACAGCGAAACCATTTCGAACAGCTCAAGGCAGCTCACGAGGACGGATCATCATGA
Gene >Ophun1|4992
ATGGATGCGTTGGAGAAGCTACTCAGCGCAGGCAAGGATGGCTCACAGCCTGCCCCCTTGATCGAGCGAGACCTC
GATTTTAATCCGGACTTTGGTGGTCTATCTCTCAAAGAACTTGTGGAAGAGGCTGATCAAGGCACTCCCCGGCGC
CTGCTTGCGGTTGAGGAATGTAGGCCACTTCTCGCCCCCTAGACCAGTCATGGAGGCATCTACTAATACCGGCGA
GTAGGCGAAGCAGACAAGTTCAAGTTCGACGGACTCCACAACTCAATTGTCGCCTGCGACGACATATTGAAATCT
GTGGAGACAAACTTGGCCAGCTTTCGCAACGATCTCGCCGCAGTCTCTGCCGACATCGAGACCCTGCAATCCCGA
TCGGGTGCCTTGAATCAGCGGCTAGAAAACCGCAATGAAGTAGAAAGAGCACTTGGACCGCTGGTGGAGGAGCTC
AGTGTCCCGCCCGACATCGTATCCAAGATATCTGAGGGCGCCATTGATGACCAGTGGCTCAAGGCCTTGTCCGAA
GTGGACAGGAGAGCTGCCGCGCAAGAGAAGAATACGGCGCCTGGATCCGGCCATCTCAAAGCATTCGAAGAGCTC
GGCCCATTGCTGGAGAAGCTTACCTTGAGAGTATTGTGCCACCGAAGTGCGCTCTCCCTCAAAGCCAAAGCCAAC
TGACAGTTATGGTAGGCCATTGAGCGCATTCGCGATTATCTCGTCACCCAGATCAAGGCGCTCCGATCTCCCCAC
ATCGATGCTCAGATAATACAGCAGCAAAAGTTTCTAAAGTTCAAGGATCTGTTTTCTTTCCTGCACAGACACCAC
GCGACGCTCGCCCAAGAGATATCACTGGCGTACATGAACACAATGCGATGGTATTATATCAACCAGTTCAGTCGC
TACGAGAAAGCCCTGGCCAAAATCAAACTACACGCACTGGACAAAAATGACACGCTGGGTCACGAGGACGCAACG
CGGATGGCGGCTATGCTTTCGACTTCGCGTGTCGCGGGCCCTCATCACGACGCGTTCAATTTGGGACGTCGGATA
ACCCTTCTGAAAGCCAAGAATCAGCCCGCCTTGTCCTCATATCTGGCCGAGGAAGACCAGTCAACACACTACCTC
GAGGTCCCGTTCCGCAACTTCAACCTCGCCTTGGTCGATAACGCAACTGCCGAGTATACCTTCCTGGCGTCCTTC
TTTCACCCGGCTCTGTCTCTTTCCCAGGTGTCGAAGAACTTCAACTACATCTTCGAGCCAACCTTTGAACTTGGT
CGGACACTGTCCAAGTCACTTGTTGGAGAGACGTATGATGCTCTTGGTGTTCTCATGTGTATCCGCCTCAACCAG
CAGTTTGCATTCGAGCTACAGCGACGAAAGGTTCCAGCCGTGGACGGCTACGTCAACGCAACCAACATGCTTCTG
TGGCCTCGGCTCCAGGTCGTCATGGACCGTCACTGCGAATCCGTGAGGCAGCTAACGAGTTCTCTACCCGCACGG
CCCTCTCGGTCCGGAGCAGACCAGTCGAGGGCGACGGCCGCGCCACACGTCGTGACTCAGCGGTTTGGACAGATC
CTCCACGGCTTTCTGGCCCTCAGTGCTGAGGCTGGGGACGACGAGCCGGTCGTTGCGAGCCTGCAGCGGTTGCGC
TCCGACGTCGAGGCTTTTCTGACGCGACAAAGCCAGCTGTACGGCAACGAAAAGCGCAAGAACAACCGGTTCCTC
TACAACAACTTTTCTCTGATTCTCACCATCATGGGTGACACTGATGGAAGGCTGGCCGCGGAACAGCGAAACCAT
TTCGAACAGCTCAAGGCAGCTCACGAGGACGGATCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail