Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4991
Gene name
LocationContig_476:591..1964
Strand+
Gene length (bp)1373
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 5.8E-14 50 210

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94661|GYP10_SCHPO GTPase-activating protein gyp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp10 PE=3 SV=1 43 291 1.0E-34
sp|Q9D9I4|TBC20_MOUSE TBC1 domain family member 20 OS=Mus musculus GN=Tbc1d20 PE=1 SV=1 26 251 2.0E-26
sp|Q2T9Q1|TBC20_BOVIN TBC1 domain family member 20 OS=Bos taurus GN=TBC1D20 PE=2 SV=1 83 251 2.0E-25
sp|Q96BZ9|TBC20_HUMAN TBC1 domain family member 20 OS=Homo sapiens GN=TBC1D20 PE=1 SV=1 83 251 6.0E-25
sp|P43570|GYP8_YEAST GTPase-activating protein GYP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP8 PE=1 SV=1 68 210 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 310 327 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4991
MAADAGPSFLVYHRRTRKSVAALDRPALKKLPGSTGPPYRATETSTKSSSTSTVPSSTTRTTDAELAQRKADLSS
VIIEVLRRHPYLCYFQGFHDICQVILLVLGPARPAEVVARLSVLRIRDFMLPTLGPTTTQLRLLPDILSKADPEM
RCHIASIEPFYALAGTLTMYAHNIEDYHDIARLFDVFLAREPVFSIYVFAQILINRRDEIFEVDESDMLQVILAK
VPAKMNLDDLIAKTVGIFNRYPPESLPSWREISKASVLKTVRHVEDLADMSLDHGHVYFQQQVKEMWWSGVVDGA
KLTIRRHRRPIVAVGMAIGVAATAIYLRRNPSALHRIMSPFQA*
Coding >Ophun1|4991
ATGGCTGCAGACGCGGGCCCATCCTTCTTGGTCTACCATCGCCGCACCCGGAAGTCGGTGGCCGCCCTGGACCGC
CCTGCCTTGAAGAAGCTTCCCGGGTCGACTGGACCGCCTTACCGTGCCACAGAGACGAGCACCAAGTCCAGCTCG
ACGTCGACCGTTCCTTCATCTACTACCCGAACGACGGACGCCGAACTGGCCCAACGCAAGGCAGATTTGTCATCC
GTCATCATCGAGGTCTTGCGTCGGCACCCATACTTGTGCTATTTTCAGGGTTTCCATGACATCTGCCAGGTAATC
CTACTGGTCTTAGGCCCTGCACGGCCAGCAGAGGTCGTTGCCCGGCTCTCCGTCCTCCGCATACGCGACTTCATG
TTGCCCACACTAGGGCCCACGACGACTCAACTGAGGTTGCTTCCCGACATACTGTCCAAGGCGGATCCCGAAATG
CGATGTCACATTGCCTCGATAGAGCCCTTTTACGCCCTGGCCGGCACCTTGACCATGTACGCTCACAACATTGAA
GATTACCACGACATAGCGCGGCTATTCGACGTCTTTCTCGCCCGTGAGCCTGTCTTCAGCATATATGTGTTCGCC
CAAATTCTCATAAACCGCCGTGACGAGATCTTCGAGGTAGACGAGTCCGACATGCTCCAGGTTATCCTGGCCAAG
GTTCCCGCCAAGATGAACCTCGACGACCTCATCGCCAAAACGGTTGGTATCTTCAACCGCTATCCGCCGGAGTCG
CTGCCATCGTGGAGGGAAATCTCAAAAGCGAGTGTCTTGAAGACGGTCAGACATGTCGAAGACCTCGCCGACATG
TCACTGGATCATGGCCACGTTTATTTCCAGCAGCAAGTCAAGGAGATGTGGTGGTCGGGCGTCGTCGACGGCGCG
AAGCTAACGATCAGGAGACATCGTCGGCCGATTGTGGCCGTTGGGATGGCTATAGGCGTTGCCGCTACAGCAATC
TACCTACGGCGTAACCCGAGTGCGCTGCACCGCATAATGTCGCCATTTCAAGCGTGA
Transcript >Ophun1|4991
ATGGCTGCAGACGCGGGCCCATCCTTCTTGGTCTACCATCGCCGCACCCGGAAGTCGGTGGCCGCCCTGGACCGC
CCTGCCTTGAAGAAGCTTCCCGGGTCGACTGGACCGCCTTACCGTGCCACAGAGACGAGCACCAAGTCCAGCTCG
ACGTCGACCGTTCCTTCATCTACTACCCGAACGACGGACGCCGAACTGGCCCAACGCAAGGCAGATTTGTCATCC
GTCATCATCGAGGTCTTGCGTCGGCACCCATACTTGTGCTATTTTCAGGGTTTCCATGACATCTGCCAGGTAATC
CTACTGGTCTTAGGCCCTGCACGGCCAGCAGAGGTCGTTGCCCGGCTCTCCGTCCTCCGCATACGCGACTTCATG
TTGCCCACACTAGGGCCCACGACGACTCAACTGAGGTTGCTTCCCGACATACTGTCCAAGGCGGATCCCGAAATG
CGATGTCACATTGCCTCGATAGAGCCCTTTTACGCCCTGGCCGGCACCTTGACCATGTACGCTCACAACATTGAA
GATTACCACGACATAGCGCGGCTATTCGACGTCTTTCTCGCCCGTGAGCCTGTCTTCAGCATATATGTGTTCGCC
CAAATTCTCATAAACCGCCGTGACGAGATCTTCGAGGTAGACGAGTCCGACATGCTCCAGGTTATCCTGGCCAAG
GTTCCCGCCAAGATGAACCTCGACGACCTCATCGCCAAAACGGTTGGTATCTTCAACCGCTATCCGCCGGAGTCG
CTGCCATCGTGGAGGGAAATCTCAAAAGCGAGTGTCTTGAAGACGGTCAGACATGTCGAAGACCTCGCCGACATG
TCACTGGATCATGGCCACGTTTATTTCCAGCAGCAAGTCAAGGAGATGTGGTGGTCGGGCGTCGTCGACGGCGCG
AAGCTAACGATCAGGAGACATCGTCGGCCGATTGTGGCCGTTGGGATGGCTATAGGCGTTGCCGCTACAGCAATC
TACCTACGGCGTAACCCGAGTGCGCTGCACCGCATAATGTCGCCATTTCAAGCGTGA
Gene >Ophun1|4991
ATGGCTGCAGACGCGGTCAGTCCACCGCTCGATGTCCCATCACGCATTCAAACACTAGACGTCGACGCCCTTCGT
GTTCAGCAGAAGACGAGAGAAATCCTCGACGCCTGCAGATGGAGAGACGTGGCAGCTCTCGCGTCGCTTGCTGAG
TCATGGCGGGGTCTGCTTGACGACGACTTACGCAGAATAGCATGTGCGTCTGCTCCTTTGATTTGGCCTGGAGTT
GCCGCGGGCTCTTGTTCGCTGAAAGCTTGCTGACGCAAGTTCTTTCTGTCCCAGGGCCCATCCTTCTTGGTCTAC
CATCGCCGCACCCGGAAGTCGGTGGCCGCCCTGGACCGCCCTGCCTTGAAGAAGCTTCCCGGGTCGACTGGACCG
CCTTACCGTGCCACAGAGACGAGCACCAAGTCCAGCTCGACGTCGACCGTTCCTTCATCTACTACCCGAACGGTA
CATAAATAACGCTCTCTTTCCACAATTCGAAGTCCACTCGCTGACGCTCCTCGCTTGCACCTCACTCAGGTCAGA
CGGACGCCGAACTGGCCCAACGCAAGGCAGATTTGTCATCCGTCATCATCGAGGTCTTGCGTCGGCACCCATACT
TGTGCTATTTTCAGGGTTTCCATGACATCTGCCAGGTAATCCTACTGGTCTTAGGCCCTGCACGGCCAGCAGAGG
TCGTTGCCCGGCTCTCCGTCCTCCGCATACGCGACTTCATGTTGCCCACACTAGGGCCCACGACGACTCAACTGA
GGTTGCTTCCCGACATACTGTCCAAGGCGGATCCCGAAATGCGATGTCACATTGCCTCGATAGAGCCCTTTTACG
CCCTGGCCGGCACCTTGACCATGTACGCTCACAACATTGAAGATTACCACGACATAGCGCGGCTATTCGACGTCT
TTCTCGCCCGTGAGCCTGTCTTCAGCATATATGTGTTCGCCCAAATTCTCATAAACCGCCGTGACGAGATCTTCG
AGGTAGACGAGTCCGACATGCTCCAGGTTATCCTGGCCAAGGTTCCCGCCAAGATGAACCTCGACGACCTCATCG
CCAAAACGGTTGGTATCTTCAACCGCTATCCGCCGGAGTCGCTGCCATCGTGGAGGGAAATCTCAAAAGCGAGTG
TCTTGAAGACGGTCAGACATGTCGAAGACCTCGCCGACATGTCACTGGATCATGGCCACGTTTATTTCCAGCAGC
AAGTCAAGGAGATGTGGTGGTCGGGCGTCGTCGACGGCGCGAAGCTAACGATCAGGAGACATCGTCGGCCGATTG
TGGCCGTTGGGATGGCTATAGGCGTTGCCGCTACAGCAATCTACCTACGGCGTAACCCGAGTGCGCTGCACCGCA
TAATGTCGCCATTTCAAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail