Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|499
Gene name
LocationContig_1147:573..1903
Strand+
Gene length (bp)1330
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10568 Tom37 Outer mitochondrial membrane transport complex protein 9.2E-38 19 141
PF17172 GST_N_4 Glutathione S-transferase N-terminal domain 2.1E-07 18 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA5|MTXL_SCHPO Metaxin-like protein C409.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.19c PE=3 SV=1 1 329 9.0E-23
sp|Q2TBS1|MTX1_BOVIN Metaxin-1 OS=Bos taurus GN=MTX1 PE=2 SV=1 1 137 1.0E-11
sp|Q4R3I0|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1 1 137 2.0E-11
sp|P47802|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1 1 151 6.0E-11
sp|Q27HK4|MTX1_PIG Metaxin-1 OS=Sus scrofa GN=MTX1 PE=2 SV=1 1 151 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA5|MTXL_SCHPO Metaxin-like protein C409.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.19c PE=3 SV=1 1 329 9.0E-23
sp|Q2TBS1|MTX1_BOVIN Metaxin-1 OS=Bos taurus GN=MTX1 PE=2 SV=1 1 137 1.0E-11
sp|Q4R3I0|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1 1 137 2.0E-11
sp|P47802|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1 1 151 6.0E-11
sp|Q27HK4|MTX1_PIG Metaxin-1 OS=Sus scrofa GN=MTX1 PE=2 SV=1 1 151 7.0E-11
sp|Q4VBW0|MTX3_DANRE Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2 1 137 7.0E-11
sp|Q13505|MTX1_HUMAN Metaxin-1 OS=Homo sapiens GN=MTX1 PE=1 SV=2 1 137 2.0E-10
sp|Q5HYI7|MTX3_HUMAN Metaxin-3 OS=Homo sapiens GN=MTX3 PE=1 SV=2 1 137 5.0E-10
sp|Q9VHB6|MTX1_DROME Metaxin-1 homolog OS=Drosophila melanogaster GN=CG9393 PE=2 SV=1 3 277 6.0E-10
sp|Q3KPT9|MTX3_XENLA Metaxin-3 OS=Xenopus laevis GN=mtx3 PE=2 SV=2 1 160 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0001401 SAM complex Yes
GO:0098796 membrane protein complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0005742 mitochondrial outer membrane translocase complex No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 331 350 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|499
MELHVWGPAFGLASVDAECLAAIAYLGCAVGRGGWRLVASSDPSRSPHHHLPSLHHHGVWVSGYAQIVDHLASHS
AHLDRHLDASQKAHVAAYSAFLSAQAAPLVGLSLYVSAANWSATTRPAYSAILPFPLTWTVPPLIRAEAVGHLGQ
LGLAELDADLDPCSSPLNAGRHVLPEALRRRLPATSTKSVRDEMTPEQAAAIRLTAVIEASLSVLDAQLKGRPAL
RFVPDASVSSLDCLAYGYLALMLKPDVPRPFLRDWILSHAPLLSSFVDAMTPTDLPWLAPEPPTLLASSLRFFDS
LVRNVPTLGEMYADEVTLRARRGIRGLDRRILTLLAGLTVTGLAVGYGVYTYRSLQPFGAASQVWRAGRAGSGPR
YGDFGSIMTGALGLYRTAASMPFKPTAEGRLMEVDSEVD*
Coding >Ophun1|499
ATGGAGCTCCACGTCTGGGGCCCGGCCTTTGGGCTTGCCTCGGTTGACGCCGAGTGTTTGGCTGCCATCGCCTAT
CTTGGCTGCGCCGTGGGTCGAGGCGGTTGGCGGCTGGTCGCCAGCAGTGATCCGTCTCGTAGTCCTCATCATCAT
CTCCCGTCGCTGCATCATCATGGCGTCTGGGTCAGCGGTTATGCCCAGATCGTCGACCATCTCGCTTCCCACTCG
GCCCACCTGGATCGCCATCTGGACGCGTCGCAAAAGGCTCACGTCGCCGCCTATTCCGCCTTCTTGTCCGCTCAA
GCCGCGCCCCTCGTCGGCCTCTCCCTCTATGTCTCGGCCGCAAACTGGTCAGCCACGACGAGGCCGGCCTACAGC
GCCATCCTCCCCTTCCCCCTTACCTGGACCGTCCCCCCCTTGATCCGCGCCGAGGCCGTCGGCCACCTTGGTCAG
CTGGGGCTCGCCGAGCTCGACGCCGACTTGGACCCATGCTCGAGTCCTCTTAACGCCGGTCGACATGTCCTGCCC
GAGGCTCTGCGGAGACGGCTGCCCGCCACGTCGACCAAGTCGGTCCGTGACGAGATGACGCCCGAACAGGCGGCT
GCCATCAGGCTCACGGCCGTCATCGAAGCAAGTCTCTCCGTCTTGGACGCCCAGCTCAAGGGCCGTCCGGCTCTT
CGCTTCGTCCCCGACGCCTCCGTATCCTCCCTCGACTGCTTGGCCTACGGCTACCTCGCCCTCATGCTCAAGCCC
GACGTCCCGCGTCCCTTTCTGCGTGACTGGATCCTCTCCCACGCTCCGCTCCTCAGCAGTTTCGTCGACGCCATG
ACGCCCACGGACCTGCCATGGCTCGCCCCGGAACCCCCCACGCTGCTGGCTTCTAGCCTCCGCTTTTTTGACTCG
CTCGTCCGCAACGTCCCCACGCTCGGCGAGATGTACGCCGACGAAGTGACGCTGCGTGCCAGGAGGGGCATCCGA
GGTCTGGACCGCAGGATCCTGACTTTGCTGGCCGGGTTAACGGTTACCGGCCTGGCCGTCGGCTACGGCGTCTAC
ACGTACAGGTCTCTCCAGCCTTTTGGTGCCGCCTCCCAAGTATGGAGGGCCGGCCGGGCCGGGTCCGGGCCGAGA
TACGGCGACTTCGGATCTATCATGACCGGCGCGCTGGGGCTCTACCGGACCGCCGCGTCTATGCCGTTTAAGCCG
ACCGCCGAGGGACGCTTGATGGAGGTGGATTCCGAGGTGGACTAG
Transcript >Ophun1|499
ATGGAGCTCCACGTCTGGGGCCCGGCCTTTGGGCTTGCCTCGGTTGACGCCGAGTGTTTGGCTGCCATCGCCTAT
CTTGGCTGCGCCGTGGGTCGAGGCGGTTGGCGGCTGGTCGCCAGCAGTGATCCGTCTCGTAGTCCTCATCATCAT
CTCCCGTCGCTGCATCATCATGGCGTCTGGGTCAGCGGTTATGCCCAGATCGTCGACCATCTCGCTTCCCACTCG
GCCCACCTGGATCGCCATCTGGACGCGTCGCAAAAGGCTCACGTCGCCGCCTATTCCGCCTTCTTGTCCGCTCAA
GCCGCGCCCCTCGTCGGCCTCTCCCTCTATGTCTCGGCCGCAAACTGGTCAGCCACGACGAGGCCGGCCTACAGC
GCCATCCTCCCCTTCCCCCTTACCTGGACCGTCCCCCCCTTGATCCGCGCCGAGGCCGTCGGCCACCTTGGTCAG
CTGGGGCTCGCCGAGCTCGACGCCGACTTGGACCCATGCTCGAGTCCTCTTAACGCCGGTCGACATGTCCTGCCC
GAGGCTCTGCGGAGACGGCTGCCCGCCACGTCGACCAAGTCGGTCCGTGACGAGATGACGCCCGAACAGGCGGCT
GCCATCAGGCTCACGGCCGTCATCGAAGCAAGTCTCTCCGTCTTGGACGCCCAGCTCAAGGGCCGTCCGGCTCTT
CGCTTCGTCCCCGACGCCTCCGTATCCTCCCTCGACTGCTTGGCCTACGGCTACCTCGCCCTCATGCTCAAGCCC
GACGTCCCGCGTCCCTTTCTGCGTGACTGGATCCTCTCCCACGCTCCGCTCCTCAGCAGTTTCGTCGACGCCATG
ACGCCCACGGACCTGCCATGGCTCGCCCCGGAACCCCCCACGCTGCTGGCTTCTAGCCTCCGCTTTTTTGACTCG
CTCGTCCGCAACGTCCCCACGCTCGGCGAGATGTACGCCGACGAAGTGACGCTGCGTGCCAGGAGGGGCATCCGA
GGTCTGGACCGCAGGATCCTGACTTTGCTGGCCGGGTTAACGGTTACCGGCCTGGCCGTCGGCTACGGCGTCTAC
ACGTACAGGTCTCTCCAGCCTTTTGGTGCCGCCTCCCAAGTATGGAGGGCCGGCCGGGCCGGGTCCGGGCCGAGA
TACGGCGACTTCGGATCTATCATGACCGGCGCGCTGGGGCTCTACCGGACCGCCGCGTCTATGCCGTTTAAGCCG
ACCGCCGAGGGACGCTTGATGGAGGTGGATTCCGAGGTGGACTAG
Gene >Ophun1|499
ATGGAGCTCCACGTCTGGGGCCCGGCCTTTGGGCTTGCCTCGGTTGACGCCGAGTGTTTGGCTGCCATCGCCTAT
CTTGGCTGCGCCGTGGGTCGAGGCGGTTGGCGGCTGGTCGCCAGCAGTGATCCGTCTCGTAGTCCTCATCGTCCG
TCTTCCTCCCGTCTTCCCTCCATTGGATACCTACTTGGTGCGCGTGACGTTACTGACGGGCTGTATGTGTGTGTA
TGTAGATCATCTCCCGTCGCTGCATCATCATGGCGTCTGGGTCAGCGGTTATGCCCAGATCGTCGACCATCTCGC
TTCCCACTCGGCCCACCTGGATCGCCATCTGGACGCGTCGCAAAAGGCTCACGTCGCCGCCTATTCCGCCTTCTT
GTCCGCTCAAGCCGCGCCCCTCGTCGGCCTCTCCCTCTATGTCTCGGCCGCAAACTGGTCAGCCACGACGAGGCC
GGCCTACAGCGCCATCCTCCCCTTCCCCCTTACCTGGACCGTCCCCCCCTTGATCCGCGCCGAGGCCGTCGGCCA
CCTTGGTCAGCTGGGGCTCGCCGAGCTCGACGCCGACTTGGACCCATGCTCGAGTCCTCTTAACGCCGGTCGACA
TGTCCTGCCCGAGGCTCTGCGGAGACGGCTGCCCGCCACGTCGACCAAGTCGGTCCGTGACGAGATGACGCCCGA
ACAGGCGGCTGCCATCAGGCTCACGGCCGTCATCGAAGCAAGTCTCTCCGTCTTGGACGCCCAGCTCAAGGGCCG
TCCGGCTCTTCGCTTCGTCCCCGACGCCTCCGTATCCTCCCTCGACTGCTTGGCCTACGGCTACCTCGCCCTCAT
GCTCAAGCCCGACGTCCCGCGTCCCTTTCTGCGTGACTGGATCCTCTCCCACGCTCCGCTCCTCAGCAGTTTCGT
CGACGCCATGACGCCCACGGACCTGCCATGGCTCGCCCCGGAACCCCCCACGCTGCTGGCTTCTAGCCTCCGCTT
TTTTGACTCGCTCGTCCGCAACGTCCCCACGCTCGGCGAGATGTACGCCGACGAAGTGACGCTGCGTGCCAGGAG
GGGCATCCGAGGTCTGGACCGCAGGATCCTGACTTTGCTGGCCGGGTTAACGGTTACCGGCCTGGCCGTCGGCTA
CGGCGTCTACACGTACAGGTCTCTCCAGCCTTTTGGTGCCGCCTCCCAAGTATGGAGGGCCGGCCGGGCCGGGTC
CGGGCCGAGATACGGCGACTTCGGATCTATCATGACCGGCGCGCTGGGGCTCTACCGGACCGCCGCGTCTATGCC
GTTTAAGCCGACCGCCGAGGGACGCTTGATGGAGGTGGATTCCGAGGTGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail