Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4980
Gene name
LocationContig_474:8596..9637
Strand+
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02144 Rad1 Repair protein Rad1/Rec1/Rad17 1.9E-08 9 56
PF02144 Rad1 Repair protein Rad1/Rec1/Rad17 1.9E-52 71 306

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22193|RAD1_SCHPO DNA damage checkpoint control protein rad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad1 PE=1 SV=2 8 323 5.0E-27
sp|Q5R7X9|RAD1_PONAB Cell cycle checkpoint protein RAD1 OS=Pongo abelii GN=RAD1 PE=2 SV=1 15 322 2.0E-24
sp|O60671|RAD1_HUMAN Cell cycle checkpoint protein RAD1 OS=Homo sapiens GN=RAD1 PE=1 SV=1 15 322 2.0E-24
sp|Q9QWZ1|RAD1_MOUSE Cell cycle checkpoint protein RAD1 OS=Mus musculus GN=Rad1 PE=1 SV=1 15 322 4.0E-24

GO

GO Term Description Terminal node
GO:0000077 DNA damage checkpoint signaling Yes
GO:0051726 regulation of cell cycle No
GO:0010564 regulation of cell cycle process No
GO:0045786 negative regulation of cell cycle No
GO:0010948 negative regulation of cell cycle process No
GO:0009987 cellular process No
GO:1901988 negative regulation of cell cycle phase transition No
GO:0007165 signal transduction No
GO:0050896 response to stimulus No
GO:1901987 regulation of cell cycle phase transition No
GO:0031570 DNA integrity checkpoint signaling No
GO:0042770 signal transduction in response to DNA damage No
GO:0051716 cellular response to stimulus No
GO:0048523 negative regulation of cellular process No
GO:0033554 cellular response to stress No
GO:0000075 cell cycle checkpoint signaling No
GO:0006974 cellular response to DNA damage stimulus No
GO:0048519 negative regulation of biological process No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0035556 intracellular signal transduction No
GO:0006950 response to stress No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4980
MAPEPRPMFQAVATSTRPLFQLLRCINFAPRVHVQITDEGVRFAADHARVMQGAVLVLPLGRSAGADCSIGVAFL
DKALFASYSVNLLPTLDGEQPSDCDNFQMPLASLLEVLQIFGAVDVAARAQKAEQDPYRSNLRNYRPDAFSNQTL
GLSGTCTLTYVQKGDAFNITIDESGVKTTAGLTTYLPEIPEDIPFDRNDVAFKIIMQSRTLLDSLAEISPTAPIR
LAITVTKTAPYLSLTGTSDLGSSGVDFTRGRDLLETFSIAGRWSQTYKFDLIKSSSEAMRIASKVSLRGDGQGVL
SLQFMVDMEGGKKSFLDFRFVPFANYDGDEDEDGEGDEGDEGDEED*
Coding >Ophun1|4980
ATGGCTCCGGAACCGCGCCCCATGTTTCAGGCGGTGGCTACGTCTACGCGGCCGCTCTTCCAGCTCCTCCGCTGC
ATCAACTTTGCGCCCAGGGTTCACGTCCAGATTACAGACGAGGGAGTGCGGTTCGCGGCCGATCACGCGCGCGTC
ATGCAAGGTGCCGTGCTTGTTCTACCACTTGGCCGTTCTGCCGGTGCTGACTGCTCAATAGGCGTCGCCTTCTTG
GACAAGGCTCTCTTCGCCTCGTACTCGGTCAATCTCTTGCCGACGTTGGATGGGGAGCAGCCGTCGGACTGTGAC
AACTTTCAGATGCCGCTGGCGTCGCTGCTCGAGGTCCTTCAGATCTTTGGCGCCGTCGATGTGGCGGCACGGGCG
CAAAAGGCCGAGCAGGATCCGTACCGGAGCAACCTGCGCAACTACCGGCCCGATGCCTTTAGCAACCAGACGCTC
GGCCTATCCGGGACGTGCACCTTGACGTACGTTCAAAAGGGAGATGCGTTCAACATCACCATCGACGAGTCTGGC
GTCAAGACGACGGCCGGCCTCACCACGTACCTCCCCGAGATACCAGAGGATATTCCCTTTGACCGCAACGATGTG
GCCTTTAAAATCATCATGCAGTCGCGCACCCTGCTCGACTCGCTCGCCGAGATTTCTCCCACGGCGCCCATCAGG
CTCGCCATTACCGTCACCAAGACGGCCCCTTATCTCTCCCTGACGGGTACCAGCGATCTCGGCAGCTCAGGCGTG
GATTTCACCCGGGGAAGGGACCTGCTCGAGACCTTTTCCATTGCGGGCCGCTGGTCTCAGACGTACAAGTTTGAT
CTCATCAAGAGCTCGAGCGAGGCGATGCGCATCGCGAGCAAGGTCAGCCTCCGGGGCGATGGCCAGGGTGTCCTC
AGCCTGCAGTTTATGGTGGACATGGAGGGGGGCAAGAAGAGCTTCCTGGACTTTCGGTTCGTGCCTTTTGCGAAT
TACGACGGGGACGAGGACGAGGATGGAGAGGGGGACGAGGGGGACGAGGGAGACGAAGAGGATTGA
Transcript >Ophun1|4980
ATGGCTCCGGAACCGCGCCCCATGTTTCAGGCGGTGGCTACGTCTACGCGGCCGCTCTTCCAGCTCCTCCGCTGC
ATCAACTTTGCGCCCAGGGTTCACGTCCAGATTACAGACGAGGGAGTGCGGTTCGCGGCCGATCACGCGCGCGTC
ATGCAAGGTGCCGTGCTTGTTCTACCACTTGGCCGTTCTGCCGGTGCTGACTGCTCAATAGGCGTCGCCTTCTTG
GACAAGGCTCTCTTCGCCTCGTACTCGGTCAATCTCTTGCCGACGTTGGATGGGGAGCAGCCGTCGGACTGTGAC
AACTTTCAGATGCCGCTGGCGTCGCTGCTCGAGGTCCTTCAGATCTTTGGCGCCGTCGATGTGGCGGCACGGGCG
CAAAAGGCCGAGCAGGATCCGTACCGGAGCAACCTGCGCAACTACCGGCCCGATGCCTTTAGCAACCAGACGCTC
GGCCTATCCGGGACGTGCACCTTGACGTACGTTCAAAAGGGAGATGCGTTCAACATCACCATCGACGAGTCTGGC
GTCAAGACGACGGCCGGCCTCACCACGTACCTCCCCGAGATACCAGAGGATATTCCCTTTGACCGCAACGATGTG
GCCTTTAAAATCATCATGCAGTCGCGCACCCTGCTCGACTCGCTCGCCGAGATTTCTCCCACGGCGCCCATCAGG
CTCGCCATTACCGTCACCAAGACGGCCCCTTATCTCTCCCTGACGGGTACCAGCGATCTCGGCAGCTCAGGCGTG
GATTTCACCCGGGGAAGGGACCTGCTCGAGACCTTTTCCATTGCGGGCCGCTGGTCTCAGACGTACAAGTTTGAT
CTCATCAAGAGCTCGAGCGAGGCGATGCGCATCGCGAGCAAGGTCAGCCTCCGGGGCGATGGCCAGGGTGTCCTC
AGCCTGCAGTTTATGGTGGACATGGAGGGGGGCAAGAAGAGCTTCCTGGACTTTCGGTTCGTGCCTTTTGCGAAT
TACGACGGGGACGAGGACGAGGATGGAGAGGGGGACGAGGGGGACGAGGGAGACGAAGAGGATTGA
Gene >Ophun1|4980
ATGGCTCCGGAACCGCGCCCCATGTTTCAGGCGGTGGCTACGTCTACGCGGCCGCTCTTCCAGCTCCTCCGCTGC
ATCAACTTTGCGCCCAGGGTTCACGTCCAGATTACAGACGAGGGAGTGCGGTTCGCGGCCGATCACGCGCGCGTC
ATGCAAGGTGCCGTGCTTGTTCTACCACTTGGCCGTTCTGCCGGTGCTGACTGCTCAATAGGCGTCGCCTTCTTG
GACAAGGCTCTCTTCGCCTCGTACTCGGTCAATCTCTTGCCGACGTTGGATGGGGAGCAGCCGTCGGACTGTGAC
AACTTTCAGATGCCGCTGGCGTCGCTGCTCGAGGTCCTTCAGATCTTTGGCGCCGTCGATGTGGCGGCACGGGCG
CAAAAGGCCGAGCAGGATCCGTACCGGAGCAACCTGCGCAACTACCGGCCCGATGCCTTTAGCAACCAGACGCTC
GGCCTATCCGGGACGTGCACCTTGACGTACGTTCAAAAGGGAGATGCGTTCAACATCACCATCGACGAGTCTGGC
GTCAAGACGACGGCCGGCCTCACCACGTACCTCCCCGAGATACCAGAGGATATTCCCTTTGACCGCAACGATGTG
GCCTTTAAAATCATCATGCAGTCGCGCACCCTGCTCGACTCGCTCGCCGAGATTTCTCCCACGGCGCCCATCAGG
CTCGCCATTACCGTCACCAAGACGGCCCCTTATCTCTCCCTGACGGGTACCAGCGATCTCGGCAGCTCAGGCGTG
GATTTCACCCGGGGAAGGGACCTGCTCGAGACCTTTTCCATTGCGGGCCGCTGGTCTCAGACGTACAAGTTTGAT
CTCATCAAGAGCTCGAGCGAGGCGATGCGCATCGCGAGCAAGGTCAGCCTCCGGGGCGATGGCCAGGGTGTCCTC
AGCCTGCAGTTTATGGTGGACATGGAGGGGGGCAAGAAGAGCTTCCTGGACTTTCGGTTCGTGCCTTTTGCGAAT
TACGACGGGGACGAGGACGAGGATGGAGAGGGGGACGAGGGGGACGAGGGAGACGAAGAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail