Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4975
Gene name
LocationContig_474:635..1529
Strand-
Gene length (bp)894
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 3.3E-14 51 110
PF04193 PQ-loop PQ loop repeat 2.5E-07 166 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R0Q9|MPU1_MOUSE Mannose-P-dolichol utilization defect 1 protein OS=Mus musculus GN=Mpdu1 PE=1 SV=1 19 257 7.0E-45
sp|O75352|MPU1_HUMAN Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens GN=MPDU1 PE=1 SV=2 18 253 3.0E-43
sp|Q60441|MPU1_CRIGR Mannose-P-dolichol utilization defect 1 protein OS=Cricetulus griseus GN=MPDU1 PE=2 SV=2 18 256 2.0E-41
sp|Q9VMW8|MPU1_DROME Mannose-P-dolichol utilization defect 1 protein homolog OS=Drosophila melanogaster GN=CG3792 PE=1 SV=2 19 249 3.0E-37
sp|Q20157|MPU1_CAEEL Mannose-P-dolichol utilization defect 1 protein homolog OS=Caenorhabditis elegans GN=F38E1.9 PE=3 SV=2 19 257 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R0Q9|MPU1_MOUSE Mannose-P-dolichol utilization defect 1 protein OS=Mus musculus GN=Mpdu1 PE=1 SV=1 19 257 7.0E-45
sp|O75352|MPU1_HUMAN Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens GN=MPDU1 PE=1 SV=2 18 253 3.0E-43
sp|Q60441|MPU1_CRIGR Mannose-P-dolichol utilization defect 1 protein OS=Cricetulus griseus GN=MPDU1 PE=2 SV=2 18 256 2.0E-41
sp|Q9VMW8|MPU1_DROME Mannose-P-dolichol utilization defect 1 protein homolog OS=Drosophila melanogaster GN=CG3792 PE=1 SV=2 19 249 3.0E-37
sp|Q20157|MPU1_CAEEL Mannose-P-dolichol utilization defect 1 protein homolog OS=Caenorhabditis elegans GN=F38E1.9 PE=3 SV=2 19 257 4.0E-31
sp|Q8VY63|MPU12_ARATH Mannose-P-dolichol utilization defect 1 protein homolog 2 OS=Arabidopsis thaliana GN=At4g07390 PE=2 SV=1 40 244 1.0E-26
sp|Q9LTI3|MPU11_ARATH Mannose-P-dolichol utilization defect 1 protein homolog 1 OS=Arabidopsis thaliana GN=At5g59470 PE=2 SV=1 40 256 3.0E-22
sp|Q8C6U2|PQLC3_MOUSE PQ-loop repeat-containing protein 3 OS=Mus musculus GN=Pqlc3 PE=1 SV=1 60 244 6.0E-15
sp|Q8N755|PQLC3_HUMAN PQ-loop repeat-containing protein 3 OS=Homo sapiens GN=PQLC3 PE=2 SV=1 60 244 1.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 82 101 19
2 111 133 22
3 138 155 17
4 165 187 22
5 194 213 19
6 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4975
MDTLRAGLQPLTHNLPVPLRDLGVSLLGPDCYRSLVLDIDLSASECLKLAVSKGLGVAIVCAASVVKLPQIIKLM
RARSADGVSFLSYLLETSALLITLAYNVRNGFPFSTYGESALILAQDVVISVLVLNYGGKAPAAAVMVAALAAAA
TLLFSDSPLGPDKLAYLQAAAGLLGVASKLPQIAAIWQQGGTGQLSAFAVFNYLLGSLSRIFTTLQEVDDKLILY
GFVSGFILNAILALQMLYYWNAPSEKVRGKRRETPMAMTTATSTSGKSPTTRRRG*
Coding >Ophun1|4975
ATGGACACCCTCCGCGCCGGCCTCCAGCCGCTGACGCACAATCTCCCCGTCCCTCTGCGCGACCTGGGCGTCTCT
CTCCTCGGTCCCGACTGCTATCGCTCACTCGTGCTCGATATCGACCTCTCGGCCTCGGAATGCCTCAAGCTGGCC
GTCAGCAAGGGCCTCGGCGTGGCCATCGTCTGCGCCGCCTCGGTCGTCAAGCTGCCTCAGATCATCAAGCTCATG
CGCGCTCGCTCTGCCGACGGCGTCTCTTTCCTGTCGTATCTGCTCGAGACGAGCGCGCTCCTCATCACGCTCGCC
TACAACGTCCGCAATGGCTTCCCCTTTAGCACCTACGGCGAATCGGCCTTGATCCTCGCCCAGGACGTCGTCATC
TCCGTTCTCGTTCTCAACTACGGCGGTAAGGCGCCCGCCGCGGCCGTCATGGTCGCTGCTCTCGCCGCCGCTGCC
ACACTGCTCTTCTCCGATAGCCCCCTGGGTCCCGACAAGTTGGCCTACTTGCAGGCCGCCGCCGGACTCCTGGGC
GTCGCCAGCAAGCTTCCGCAGATCGCGGCCATCTGGCAACAGGGAGGCACCGGCCAGCTGAGCGCATTTGCTGTC
TTCAATTACCTCCTCGGCTCGCTGTCGCGCATCTTCACGACTCTGCAAGAGGTCGACGACAAGCTTATTCTCTAC
GGCTTCGTGTCCGGCTTCATCCTCAACGCCATCCTCGCTCTGCAAATGTTATACTATTGGAACGCGCCGTCGGAA
AAGGTCAGGGGCAAGCGCAGGGAGACGCCCATGGCCATGACGACGGCCACATCGACGTCAGGCAAGAGCCCGACG
ACTCGGCGTCGAGGATAG
Transcript >Ophun1|4975
ATGGACACCCTCCGCGCCGGCCTCCAGCCGCTGACGCACAATCTCCCCGTCCCTCTGCGCGACCTGGGCGTCTCT
CTCCTCGGTCCCGACTGCTATCGCTCACTCGTGCTCGATATCGACCTCTCGGCCTCGGAATGCCTCAAGCTGGCC
GTCAGCAAGGGCCTCGGCGTGGCCATCGTCTGCGCCGCCTCGGTCGTCAAGCTGCCTCAGATCATCAAGCTCATG
CGCGCTCGCTCTGCCGACGGCGTCTCTTTCCTGTCGTATCTGCTCGAGACGAGCGCGCTCCTCATCACGCTCGCC
TACAACGTCCGCAATGGCTTCCCCTTTAGCACCTACGGCGAATCGGCCTTGATCCTCGCCCAGGACGTCGTCATC
TCCGTTCTCGTTCTCAACTACGGCGGTAAGGCGCCCGCCGCGGCCGTCATGGTCGCTGCTCTCGCCGCCGCTGCC
ACACTGCTCTTCTCCGATAGCCCCCTGGGTCCCGACAAGTTGGCCTACTTGCAGGCCGCCGCCGGACTCCTGGGC
GTCGCCAGCAAGCTTCCGCAGATCGCGGCCATCTGGCAACAGGGAGGCACCGGCCAGCTGAGCGCATTTGCTGTC
TTCAATTACCTCCTCGGCTCGCTGTCGCGCATCTTCACGACTCTGCAAGAGGTCGACGACAAGCTTATTCTCTAC
GGCTTCGTGTCCGGCTTCATCCTCAACGCCATCCTCGCTCTGCAAATGTTATACTATTGGAACGCGCCGTCGGAA
AAGGTCAGGGGCAAGCGCAGGGAGACGCCCATGGCCATGACGACGGCCACATCGACGTCAGGCAAGAGCCCGACG
ACTCGGCGTCGAGGATAG
Gene >Ophun1|4975
ATGGACACCCTCCGCGCCGGCCTCCAGCCGCTGACGCACAATCTCCCCGTCCCTCTGCGCGACCTGGGCGTCTCT
CTCCTCGGTCCCGACTGCTATCGCTCACTCGTGCTCGATATCGACCTCTCGGCCTCGGAATGCCTCAAGCTGGCC
GTCAGCAAGGGCCTCGGCGTGGCCATCGTCTGCGCCGCCTCGGTCGTCAAGCTGCCTCAGATCATCAAGCTCATG
CGCGCTCGCTCTGCCGACGGCGTCTCTTTCCTGTCGTATCTGCTCGAGACGAGCGCGCTCCTCATCACGCTCGCC
TACAACGTCCGCAATGGCTTCCCCTTTAGCACCTACGGCGAATCGGCCTTGATCCTCGCCCAGGACGTCGTCATC
TCCGTTCTCGTTCTCAACTACGGCGGTAAGGCGCCCGCCGCGGCCGTCATGGTCGCTGCTCTCGCCGCCGCTGCC
ACACTGCTCTTCTCCGATAGCCCCCTGGGTCCCGACAAGTTGGCCTACTTGCAGGCCGCCGCCGGACTCCTGGGC
GTCGCCAGCAAGCTTCCGCAGATCGCGGCCATCTGGCAACAGGGAGGCACCGGCCAGCTGAGCGCATTTGCTGTA
ATCGAGGCCAAACGTACCCTCCCTTGTCGTCACTGACTGACTCTTCAGGTCTTCAATTACCTCCTCGGCTCGCTG
TCGCGCATCTTCACGACTCTGCAAGAGGTCGACGACAAGCTTATTCTCTACGGCTTCGTGTCCGGCTTCATCCTC
AACGCCATCCTCGCTCTGCAAATGTTATACTATTGGAACGCGCCGTCGGAAAAGGTCAGGGGCAAGCGCAGGGAG
ACGCCCATGGCCATGACGACGGCCACATCGACGTCAGGCAAGAGCCCGACGACTCGGCGTCGAGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail