Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4964
Gene name
LocationContig_472:2394..5796
Strand+
Gene length (bp)3402
Transcript length (bp)3183
Coding sequence length (bp)3183
Protein length (aa) 1061

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17034 zinc_ribbon_16 Zinc-ribbon like family 2.7E-15 972 1051

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38164|SEA4_YEAST SEH-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEA4 PE=1 SV=2 551 1050 5.0E-55
sp|Q09866|YAG1_SCHPO Uncharacterized WD repeat-containing protein C12G12.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.01c PE=1 SV=2 517 1052 2.0E-46
sp|A4QNS7|MIOB_XENLA WD repeat-containing protein mio-B OS=Xenopus laevis PE=2 SV=1 663 1049 2.0E-30
sp|Q802U2|MIO_DANRE WD repeat-containing protein mio OS=Danio rerio GN=mios PE=2 SV=1 539 1049 3.0E-30
sp|Q5U5D4|MIOA_XENLA WD repeat-containing protein mio-A OS=Xenopus laevis PE=2 SV=1 663 1049 8.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38164|SEA4_YEAST SEH-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEA4 PE=1 SV=2 551 1050 5.0E-55
sp|Q09866|YAG1_SCHPO Uncharacterized WD repeat-containing protein C12G12.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.01c PE=1 SV=2 517 1052 2.0E-46
sp|A4QNS7|MIOB_XENLA WD repeat-containing protein mio-B OS=Xenopus laevis PE=2 SV=1 663 1049 2.0E-30
sp|Q802U2|MIO_DANRE WD repeat-containing protein mio OS=Danio rerio GN=mios PE=2 SV=1 539 1049 3.0E-30
sp|Q5U5D4|MIOA_XENLA WD repeat-containing protein mio-A OS=Xenopus laevis PE=2 SV=1 663 1049 8.0E-30
sp|Q9NXC5|MIO_HUMAN WD repeat-containing protein mio OS=Homo sapiens GN=MIOS PE=1 SV=2 663 1049 3.0E-29
sp|Q5RCA2|MIO_PONAB WD repeat-containing protein mio OS=Pongo abelii GN=MIOS PE=2 SV=1 661 1049 4.0E-29
sp|Q8VE19|MIO_MOUSE WD repeat-containing protein mio OS=Mus musculus GN=Mios PE=1 SV=2 661 1049 3.0E-28
sp|Q9VQ89|MIO_DROME WD repeat-containing protein mio OS=Drosophila melanogaster GN=mio PE=2 SV=2 607 1049 5.0E-21
sp|Q551B5|MIO_DICDI WD repeat-containing protein mio OS=Dictyostelium discoideum GN=DDB_G0276673 PE=3 SV=1 653 918 5.0E-19
sp|Q09866|YAG1_SCHPO Uncharacterized WD repeat-containing protein C12G12.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.01c PE=1 SV=2 69 300 5.0E-09
sp|A4QNS7|MIOB_XENLA WD repeat-containing protein mio-B OS=Xenopus laevis PE=2 SV=1 49 383 1.0E-07
sp|Q9NXC5|MIO_HUMAN WD repeat-containing protein mio OS=Homo sapiens GN=MIOS PE=1 SV=2 49 245 2.0E-07
sp|Q8VE19|MIO_MOUSE WD repeat-containing protein mio OS=Mus musculus GN=Mios PE=1 SV=2 49 245 2.0E-07
sp|Q5U5D4|MIOA_XENLA WD repeat-containing protein mio-A OS=Xenopus laevis PE=2 SV=1 49 383 3.0E-07
sp|P38164|SEA4_YEAST SEH-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEA4 PE=1 SV=2 89 238 3.0E-07
sp|Q802U2|MIO_DANRE WD repeat-containing protein mio OS=Danio rerio GN=mios PE=2 SV=1 49 241 7.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4063
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2326
Ophiocordyceps australis map64 (Brazil) OphauB2|7925
Ophiocordyceps camponoti-floridani Ophcf2|06495
Ophiocordyceps camponoti-rufipedis Ophun1|4964 (this protein)
Ophiocordyceps kimflemingae Ophio5|5156
Ophiocordyceps subramaniannii Hirsu2|8193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4964
MDRPEPGLVKWSANAAVDSFVHINLQHRVVQLYQPTGHAHKRRFDHAKLSRHDDFPPLTTYDWSAAHPELLAVGT
SSGIVNLLRIDDNSNAYVEIGLKMARTCQAVAFNSTGLLAVGLDRVRMDQSLQIWDVNRLSASENQNQGFPPDAA
SFVEPRLRLEPSVSVSSLKFFEDSPQTLVAGIKGQGLRIHDLRDATGIVTFHTKCNNNLAIDYADPNFFASSALD
HPGVMIWDRRVTSRPLASHTYLQAVEEDDLPWGGALRLNQVIETSPDLFVTEGKHSLIRSLRYCRDRRGLLAALS
PTGQLKVLETNREVQASGTAPQGAPELLQVQRSHEMDVSYRDTSRRGDRIVSFDWITLSSPVLRPRLLVLRANGN
FEVLEQPSRTSDYVFNFVPWQSPHRGLQEGAPYHDVMRFEPSQTVEMLGTFLAEQALSEVPIFGSDKARIQERLQ
GALKNKPAVSTSVEHVDENQRPLPDSFRKAKSVASKLSSLRTYVAGAEDGVATQGRAGQANDVSLASNSLGSCRE
MHEALLSSLMTAKGLPREAQSVVDHVMLSRAKENYLFDAAVNREVVSDDPWKRFVWDWIADAEQAAESGGMLLGN
IDLSFLGAHAIWTNDLGKTPGTRLAPGSAEPDSAQWERLIGQYCKKHRLPRFDGVPTKKPHHRQLCLEICGWGDG
QGHAQGAGDGAEHPTATHTMVASRALFRGDTKLAMEILKRASSTHPELLFVSLALQLTTGKAKEPLEIDDAVASK
TDPYLRAISSLIATGDWSTVANQASLPLSDRAVVAFRNLDDQDLTRWLSTQLSLAVREADLEAIVLTGVSDSLVD
VLARYVEKFNDVQTATLVSSLCHPRYMDDIRCRAWRSAYRSLLQRHRLFLHRTRFDVESTKRSKRDGLPTLKPPS
RQIALRCVYCDAETALATTHPHHHHHHHHQQQQQQQQQQQQQQQQQQQQQLHPRPTHHLESRNPLLATTINAGVS
CPNCGRHLPRCVVCLEVVGVPRSEGPEVRDESRGAAGRFPTFCLRCEHVLHLDHARLWFARHVECPVPECRCLCN
FKANPELAYP*
Coding >Ophun1|4964
ATGGACCGCCCCGAGCCGGGGCTCGTCAAATGGTCCGCCAACGCTGCCGTTGACAGCTTTGTTCACATCAATCTC
CAGCACCGCGTCGTCCAGCTCTACCAGCCGACTGGCCACGCCCACAAGCGACGCTTCGACCACGCCAAGCTGAGC
CGGCACGATGACTTTCCTCCTCTCACCACCTACGACTGGTCCGCTGCTCATCCAGAGCTTCTGGCCGTCGGTACC
AGTTCCGGAATCGTCAATCTGCTGAGAATCGACGACAATTCAAACGCCTACGTCGAGATTGGTCTCAAGATGGCT
CGCACTTGTCAGGCGGTAGCCTTCAACTCGACCGGCCTCCTCGCCGTTGGCCTCGACCGCGTGCGCATGGATCAG
AGCCTGCAGATATGGGACGTGAATCGTCTGTCAGCCTCAGAGAACCAGAATCAGGGCTTCCCCCCCGACGCTGCC
AGCTTCGTCGAGCCCCGGCTTCGTCTCGAACCTAGTGTCTCCGTCTCCAGCCTCAAGTTCTTCGAGGATAGCCCG
CAGACGCTGGTGGCAGGTATCAAGGGCCAAGGGCTGCGTATACATGATCTTCGTGATGCGACGGGCATCGTGACA
TTCCATACGAAATGCAACAACAACTTGGCCATTGACTACGCAGACCCCAACTTCTTCGCCTCTTCAGCCCTAGAC
CACCCCGGCGTCATGATCTGGGACCGCCGCGTCACCTCTCGCCCCCTGGCCTCGCACACGTACCTGCAGGCCGTC
GAGGAAGACGACTTGCCTTGGGGAGGGGCCCTGCGCCTGAACCAGGTCATCGAGACCAGTCCGGACCTGTTCGTC
ACCGAAGGCAAGCACTCTCTTATACGGTCGTTGCGGTACTGTCGCGATCGTCGAGGCCTGCTGGCCGCCCTCTCG
CCCACGGGACAGCTCAAGGTGCTAGAGACGAACAGGGAGGTGCAGGCGTCTGGCACGGCGCCGCAGGGAGCGCCC
GAGCTCCTCCAGGTACAGCGATCCCACGAAATGGACGTGTCGTATCGAGACACGTCCAGGAGAGGAGACCGCATC
GTCTCGTTCGACTGGATAACGCTGTCATCGCCCGTCTTGCGTCCACGACTCCTGGTCCTACGCGCCAATGGCAAC
TTTGAAGTGCTCGAGCAGCCATCTCGAACGTCTGACTACGTGTTTAACTTTGTGCCCTGGCAGTCGCCCCATCGC
GGGCTGCAAGAGGGTGCTCCGTATCATGACGTGATGCGATTCGAGCCTTCGCAGACGGTGGAGATGCTGGGAACG
TTTCTAGCCGAGCAGGCCTTGTCCGAAGTGCCGATATTTGGATCCGACAAGGCCCGGATTCAGGAGCGGCTGCAG
GGTGCCTTGAAGAACAAGCCGGCAGTATCAACGTCTGTCGAGCACGTCGACGAGAACCAGAGGCCCCTTCCGGAC
TCGTTCCGCAAGGCCAAGTCAGTGGCATCGAAGCTGAGCAGCCTGCGGACGTACGTGGCCGGAGCTGAGGACGGC
GTGGCAACCCAGGGCCGGGCTGGTCAGGCAAACGACGTCTCGCTGGCGTCCAACAGCCTCGGCTCCTGTCGAGAG
ATGCACGAGGCACTGCTGAGTTCGCTGATGACGGCCAAGGGCCTGCCCCGAGAAGCACAGAGCGTGGTGGACCAC
GTAATGCTGTCCCGTGCCAAGGAGAACTATCTCTTCGACGCGGCCGTCAACCGCGAGGTTGTCTCGGACGATCCC
TGGAAGCGGTTCGTGTGGGACTGGATTGCCGATGCCGAACAGGCGGCCGAGAGCGGAGGCATGCTACTGGGCAAC
ATCGATCTCAGCTTCCTGGGCGCCCACGCCATCTGGACCAACGATCTAGGCAAAACCCCCGGCACTCGTCTCGCA
CCGGGAAGCGCAGAGCCCGACTCGGCGCAGTGGGAGCGGCTCATCGGCCAGTACTGCAAGAAGCACCGGCTGCCA
CGCTTCGACGGCGTTCCCACCAAGAAGCCTCATCACCGTCAGCTGTGCCTCGAGATATGCGGCTGGGGCGACGGC
CAGGGACACGCACAGGGAGCAGGCGACGGAGCAGAGCATCCAACGGCGACTCACACAATGGTAGCATCACGAGCT
CTCTTCAGGGGAGACACCAAGCTGGCCATGGAGATACTCAAACGAGCCAGCTCAACCCACCCAGAGCTCCTCTTC
GTCTCCCTCGCCCTCCAACTGACAACAGGCAAAGCCAAAGAACCCCTCGAGATCGACGACGCCGTCGCCTCAAAG
ACAGACCCCTACCTCCGAGCCATCTCCTCCCTCATCGCAACAGGAGACTGGTCAACGGTAGCAAACCAAGCCTCC
CTCCCCCTGTCGGACCGCGCCGTCGTCGCCTTCCGCAACCTAGACGACCAAGACCTCACCCGCTGGCTCTCCACC
CAGCTCAGCCTCGCCGTCCGAGAAGCAGACCTCGAAGCCATCGTCCTAACCGGCGTAAGCGACAGCCTCGTCGAC
GTCCTCGCCCGCTACGTCGAAAAGTTCAACGACGTCCAGACTGCTACGCTCGTCTCCTCCCTCTGCCACCCTCGC
TACATGGACGATATCCGCTGCCGCGCCTGGCGATCTGCCTACCGCTCCCTCCTCCAACGACACCGCCTCTTCCTT
CACCGCACCCGCTTCGACGTCGAGTCCACCAAGCGGTCTAAACGCGATGGCCTTCCCACCCTCAAGCCCCCATCC
CGTCAGATCGCCCTCCGCTGCGTCTACTGCGACGCCGAAACAGCCCTCGCCACCACCCACCCCCATCACCATCAC
CATCATCACCACCAGCAACAACAACAACAACAACAACAACAGCAGCAGCAGCAACAACAGCAGCAACAGCAGCAG
CTTCACCCCCGCCCAACCCACCACCTCGAATCCCGCAACCCCCTCCTAGCAACAACCATCAACGCCGGCGTCAGC
TGCCCCAACTGCGGCCGCCACCTCCCCCGCTGCGTCGTCTGCCTCGAGGTTGTCGGCGTGCCGCGCTCCGAGGGC
CCCGAGGTGAGGGACGAGTCGAGGGGCGCGGCTGGGCGGTTCCCCACGTTTTGCCTCCGCTGTGAGCATGTGCTT
CATCTTGATCATGCGAGGCTGTGGTTTGCCAGGCATGTTGAGTGTCCCGTGCCCGAGTGTCGTTGTCTGTGTAAC
TTTAAGGCGAACCCCGAGCTGGCGTACCCTTGA
Transcript >Ophun1|4964
ATGGACCGCCCCGAGCCGGGGCTCGTCAAATGGTCCGCCAACGCTGCCGTTGACAGCTTTGTTCACATCAATCTC
CAGCACCGCGTCGTCCAGCTCTACCAGCCGACTGGCCACGCCCACAAGCGACGCTTCGACCACGCCAAGCTGAGC
CGGCACGATGACTTTCCTCCTCTCACCACCTACGACTGGTCCGCTGCTCATCCAGAGCTTCTGGCCGTCGGTACC
AGTTCCGGAATCGTCAATCTGCTGAGAATCGACGACAATTCAAACGCCTACGTCGAGATTGGTCTCAAGATGGCT
CGCACTTGTCAGGCGGTAGCCTTCAACTCGACCGGCCTCCTCGCCGTTGGCCTCGACCGCGTGCGCATGGATCAG
AGCCTGCAGATATGGGACGTGAATCGTCTGTCAGCCTCAGAGAACCAGAATCAGGGCTTCCCCCCCGACGCTGCC
AGCTTCGTCGAGCCCCGGCTTCGTCTCGAACCTAGTGTCTCCGTCTCCAGCCTCAAGTTCTTCGAGGATAGCCCG
CAGACGCTGGTGGCAGGTATCAAGGGCCAAGGGCTGCGTATACATGATCTTCGTGATGCGACGGGCATCGTGACA
TTCCATACGAAATGCAACAACAACTTGGCCATTGACTACGCAGACCCCAACTTCTTCGCCTCTTCAGCCCTAGAC
CACCCCGGCGTCATGATCTGGGACCGCCGCGTCACCTCTCGCCCCCTGGCCTCGCACACGTACCTGCAGGCCGTC
GAGGAAGACGACTTGCCTTGGGGAGGGGCCCTGCGCCTGAACCAGGTCATCGAGACCAGTCCGGACCTGTTCGTC
ACCGAAGGCAAGCACTCTCTTATACGGTCGTTGCGGTACTGTCGCGATCGTCGAGGCCTGCTGGCCGCCCTCTCG
CCCACGGGACAGCTCAAGGTGCTAGAGACGAACAGGGAGGTGCAGGCGTCTGGCACGGCGCCGCAGGGAGCGCCC
GAGCTCCTCCAGGTACAGCGATCCCACGAAATGGACGTGTCGTATCGAGACACGTCCAGGAGAGGAGACCGCATC
GTCTCGTTCGACTGGATAACGCTGTCATCGCCCGTCTTGCGTCCACGACTCCTGGTCCTACGCGCCAATGGCAAC
TTTGAAGTGCTCGAGCAGCCATCTCGAACGTCTGACTACGTGTTTAACTTTGTGCCCTGGCAGTCGCCCCATCGC
GGGCTGCAAGAGGGTGCTCCGTATCATGACGTGATGCGATTCGAGCCTTCGCAGACGGTGGAGATGCTGGGAACG
TTTCTAGCCGAGCAGGCCTTGTCCGAAGTGCCGATATTTGGATCCGACAAGGCCCGGATTCAGGAGCGGCTGCAG
GGTGCCTTGAAGAACAAGCCGGCAGTATCAACGTCTGTCGAGCACGTCGACGAGAACCAGAGGCCCCTTCCGGAC
TCGTTCCGCAAGGCCAAGTCAGTGGCATCGAAGCTGAGCAGCCTGCGGACGTACGTGGCCGGAGCTGAGGACGGC
GTGGCAACCCAGGGCCGGGCTGGTCAGGCAAACGACGTCTCGCTGGCGTCCAACAGCCTCGGCTCCTGTCGAGAG
ATGCACGAGGCACTGCTGAGTTCGCTGATGACGGCCAAGGGCCTGCCCCGAGAAGCACAGAGCGTGGTGGACCAC
GTAATGCTGTCCCGTGCCAAGGAGAACTATCTCTTCGACGCGGCCGTCAACCGCGAGGTTGTCTCGGACGATCCC
TGGAAGCGGTTCGTGTGGGACTGGATTGCCGATGCCGAACAGGCGGCCGAGAGCGGAGGCATGCTACTGGGCAAC
ATCGATCTCAGCTTCCTGGGCGCCCACGCCATCTGGACCAACGATCTAGGCAAAACCCCCGGCACTCGTCTCGCA
CCGGGAAGCGCAGAGCCCGACTCGGCGCAGTGGGAGCGGCTCATCGGCCAGTACTGCAAGAAGCACCGGCTGCCA
CGCTTCGACGGCGTTCCCACCAAGAAGCCTCATCACCGTCAGCTGTGCCTCGAGATATGCGGCTGGGGCGACGGC
CAGGGACACGCACAGGGAGCAGGCGACGGAGCAGAGCATCCAACGGCGACTCACACAATGGTAGCATCACGAGCT
CTCTTCAGGGGAGACACCAAGCTGGCCATGGAGATACTCAAACGAGCCAGCTCAACCCACCCAGAGCTCCTCTTC
GTCTCCCTCGCCCTCCAACTGACAACAGGCAAAGCCAAAGAACCCCTCGAGATCGACGACGCCGTCGCCTCAAAG
ACAGACCCCTACCTCCGAGCCATCTCCTCCCTCATCGCAACAGGAGACTGGTCAACGGTAGCAAACCAAGCCTCC
CTCCCCCTGTCGGACCGCGCCGTCGTCGCCTTCCGCAACCTAGACGACCAAGACCTCACCCGCTGGCTCTCCACC
CAGCTCAGCCTCGCCGTCCGAGAAGCAGACCTCGAAGCCATCGTCCTAACCGGCGTAAGCGACAGCCTCGTCGAC
GTCCTCGCCCGCTACGTCGAAAAGTTCAACGACGTCCAGACTGCTACGCTCGTCTCCTCCCTCTGCCACCCTCGC
TACATGGACGATATCCGCTGCCGCGCCTGGCGATCTGCCTACCGCTCCCTCCTCCAACGACACCGCCTCTTCCTT
CACCGCACCCGCTTCGACGTCGAGTCCACCAAGCGGTCTAAACGCGATGGCCTTCCCACCCTCAAGCCCCCATCC
CGTCAGATCGCCCTCCGCTGCGTCTACTGCGACGCCGAAACAGCCCTCGCCACCACCCACCCCCATCACCATCAC
CATCATCACCACCAGCAACAACAACAACAACAACAACAACAGCAGCAGCAGCAACAACAGCAGCAACAGCAGCAG
CTTCACCCCCGCCCAACCCACCACCTCGAATCCCGCAACCCCCTCCTAGCAACAACCATCAACGCCGGCGTCAGC
TGCCCCAACTGCGGCCGCCACCTCCCCCGCTGCGTCGTCTGCCTCGAGGTTGTCGGCGTGCCGCGCTCCGAGGGC
CCCGAGGTGAGGGACGAGTCGAGGGGCGCGGCTGGGCGGTTCCCCACGTTTTGCCTCCGCTGTGAGCATGTGCTT
CATCTTGATCATGCGAGGCTGTGGTTTGCCAGGCATGTTGAGTGTCCCGTGCCCGAGTGTCGTTGTCTGTGTAAC
TTTAAGGCGAACCCCGAGCTGGCGTACCCTTGA
Gene >Ophun1|4964
ATGGACCGCCCCGAGCCGGGGCTCGTCAAATGGTCCGCCAACGCTGCCGTTGACAGCTTTGTTCACATCAATCTC
CAGCACCGCGTCGTCCAGCTCTACCAGCCGACTGGCCACGCCCACAAGCGACGCTTCGACCACGCCAAGCTGAGC
CGGCACGATGACTTTCCTCCTCTCACCACCTACGACTGGTCCGCTGCTCATCCAGAGCTTCTGGCCGTCGGTACC
AGTTCCGGAATCGTCAATCTGCTGAGAATCGACGACAATTCAAACGCCTACGTCGAGATTGGTCTCAAGATGGCT
CGCACTTGTCAGGCGGTAGCCTTCAACTCGACCGGCCTCCTCGCCGTTGGCCTCGACCGCGTGCGCATGGATCAG
AGCCTGCAGATATGGGACGTGAATCGTCTGTCAGCCTCAGAGAACCAGAATCAGGGCTTCCCCCCCGACGCTGCC
AGCTTCGTCGAGCCCCGGCTTCGTCTCGAACCTAGTGTCTCCGTCTCCAGCCTCAAGTTCTTCGAGGATAGCCCG
CAGACGCTGGTGGCAGGTATCAAGGGCCAAGGGCTGCGTATACATGATCTTCGTGGTGAGCGAGACGGCTGCCCG
CCATCATGGTGTTGCTCTCAACTGATAATCCACGCGTCTTAGCAGATGCGACGGGCATCGTGACATTCCATACGA
AATGCAACAACAACTTGGCCATTGACTACGCAGACCCCAACTTCTTCGCCTCTTCAGCCCTAGACCACCCCGGCG
TCATGATCTGGGACCGCCGCGTCACCTCTCGCCCCCTGGCCTCGCACACGTACCTGCAGGCCGTCGAGGAAGACG
ACTTGCCTTGGGGAGGGGCCCTGCGCCTGAACCAGGTCATCGAGACCAGTCCGGACCTGTTCGTCACCGAAGGCA
AGCACTCTCTTATACGGTCGTTGCGGTACTGTCGCGATCGTCGAGGCCTGCTGGCCGCCCTCTCGCCCACGGGAC
AGCTCAAGGTGCTAGAGACGAACAGGGAGGTGCAGGCGTCTGGCACGGCGCCGCAGGGAGCGCCCGAGCTCCTCC
AGGTACAGCGATCCCACGAAATGGACGTGTCGTATCGAGACACGTCCAGGAGAGGAGACCGCATCGTCTCGTTCG
ACTGGATAACGCTGTCATCGCCCGTCTTGCGTCCACGACTCCTGGTCCTACGCGCCAATGGCAACTTTGAAGTGC
TCGAGCAGCCATCTCGAACGTCTGACTACGTGTTTAACTTTGTGCCCTGGCAGTCGCCCCATCGCGGGCTGCAAG
GTAATCATGATACAATACGACGTCTTGGACAGAGAAGGCTAAGCCGTCACAGAGGGTGCTCCGTATCATGACGTG
ATGCGATTCGAGCCTTCGCAGACGGTGGAGATGCTGGGAACGTTTCTAGCCGAGCAGGCCTTGTCCGAAGTGCCG
ATATTTGGATCCGACAAGGCCCGGATTCAGGAGCGGCTGCAGGGTGCCTTGAAGAACAAGCCGGCAGTATCAACG
TCTGTCGAGCACGTCGACGAGAACCAGAGGCCCCTTCCGGACTCGTTCCGCAAGGCCAAGTCAGTGGCATCGAAG
CTGAGCAGCCTGCGGACGTACGTGGCCGGAGCTGAGGACGGCGTGGCAACCCAGGGCCGGGCTGGTCAGGCAAAC
GACGTCTCGCTGGCGTCCAACAGCCTCGGCTCCTGTCGAGAGATGCACGAGGCACTGCTGAGTTCGCTGATGACG
GCCAAGGGCCTGCCCCGAGAAGCACAGAGCGTGGTGGACCACGTAATGCTGTCCCGTGCCAAGGAGAACTATCTC
TTCGACGCGGCCGTCAACCGCGAGGTTGTCTCGGACGATCCCTGGAAGCGGTTCGTGTGGGACTGGATTGCCGGT
GAGTCTGTTTGTTTGATCTCGTACTTGTAGAGACTTGACGCTGGGACAGATGCCGAACAGGCGGCCGAGAGCGGA
GGCATGCTACTGGGCAACATCGATCTCAGCTTCCTGGGCGCCCACGCCATCTGGACCAACGATCTAGGTGAGCAG
AGGCTTTTCAAAGAACCGAGATCCGGCTGACGATGGCTCCCAGGCAAAACCCCCGGCACTCGTCTCGCACCGGGA
AGCGCAGAGCCCGACTCGGCGCAGTGGGAGCGGCTCATCGGCCAGTACTGCAAGAAGCACCGGCTGCCACGCTTC
GACGGCGTTCCCACCAAGAAGCCTCATCACCGTCAGCTGTGCCTCGAGATATGCGGCTGGGGCGACGGCCAGGGA
CACGCACAGGGAGCAGGCGACGGAGCAGAGCATCCAACGGCGACTCACACAATGGTAGCATCACGAGCTCTCTTC
AGGGGAGACACCAAGCTGGCCATGGAGATACTCAAACGAGCCAGCTCAACCCACCCAGAGCTCCTCTTCGTCTCC
CTCGCCCTCCAACTGACAACAGGCAAAGCCAAAGAACCCCTCGAGATCGACGACGCCGTCGCCTCAAAGACAGAC
CCCTACCTCCGAGCCATCTCCTCCCTCATCGCAACAGGAGACTGGTCAACGGTAGCAAACCAAGCCTCCCTCCCC
CTGTCGGACCGCGCCGTCGTCGCCTTCCGCAACCTAGACGACCAAGACCTCACCCGCTGGCTCTCCACCCAGCTC
AGCCTCGCCGTCCGAGAAGCAGACCTCGAAGCCATCGTCCTAACCGGCGTAAGCGACAGCCTCGTCGACGTCCTC
GCCCGCTACGTCGAAAAGTTCAACGACGTCCAGACTGCTACGCTCGTCTCCTCCCTCTGCCACCCTCGCTACATG
GACGATATCCGCTGCCGCGCCTGGCGATCTGCCTACCGCTCCCTCCTCCAACGACACCGCCTCTTCCTTCACCGC
ACCCGCTTCGACGTCGAGTCCACCAAGCGGTCTAAACGCGATGGCCTTCCCACCCTCAAGCCCCCATCCCGTCAG
ATCGCCCTCCGCTGCGTCTACTGCGACGCCGAAACAGCCCTCGCCACCACCCACCCCCATCACCATCACCATCAT
CACCACCAGCAACAACAACAACAACAACAACAACAGCAGCAGCAGCAACAACAGCAGCAACAGCAGCAGCTTCAC
CCCCGCCCAACCCACCACCTCGAATCCCGCAACCCCCTCCTAGCAACAACCATCAACGCCGGCGTCAGCTGCCCC
AACTGCGGCCGCCACCTCCCCCGCTGCGTCGTCTGCCTCGAGGTTGTCGGCGTGCCGCGCTCCGAGGGCCCCGAG
GTGAGGGACGAGTCGAGGGGCGCGGCTGGGCGGTTCCCCACGTTTTGCCTCCGCTGTGAGCATGTGCTTCATCTT
GATCATGCGAGGCTGTGGTTTGCCAGGCATGTTGAGTGTCCCGTGCCCGAGTGTCGTTGTCTGTGTAACTTTAAG
GCGAACCCCGAGCTGGCGTACCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail