Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4960
Gene name
LocationContig_471:6962..8829
Strand-
Gene length (bp)1867
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 4.5E-12 206 268
PF00013 KH_1 KH domain 1.8E-15 306 369
PF00013 KH_1 KH domain 1.2E-15 409 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 205 482 2.0E-26
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 205 479 4.0E-25
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 205 479 1.0E-24
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 205 479 2.0E-24
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 205 479 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 205 482 2.0E-26
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 205 479 4.0E-25
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 205 479 1.0E-24
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 205 479 2.0E-24
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 205 479 2.0E-24
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 205 479 5.0E-21
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 205 447 2.0E-20
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 205 447 2.0E-20
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 203 474 3.0E-14
sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 281 475 9.0E-13
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 216 481 9.0E-12
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 206 474 1.0E-11
sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 281 474 1.0E-11
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 206 474 2.0E-11
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 206 474 4.0E-11
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 281 474 1.0E-10
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 281 474 2.0E-10
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 281 474 3.0E-10
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 305 470 6.0E-10
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 301 474 8.0E-10
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 305 470 8.0E-10
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 200 374 1.0E-09
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 200 374 3.0E-09
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 200 475 2.0E-08
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 200 475 2.0E-08
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 305 470 3.0E-08
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 305 470 3.0E-08
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 200 475 3.0E-08
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 305 470 6.0E-08
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 305 470 6.0E-08
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 305 470 6.0E-08
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 305 470 6.0E-08
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 200 475 8.0E-08
sp|Q5ZLP8|IF2B3_CHICK Insulin-like growth factor 2 mRNA-binding protein 3 OS=Gallus gallus GN=IGF2BP3 PE=2 SV=1 305 474 2.0E-07
sp|O57526|IF23B_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-B OS=Xenopus laevis GN=igf2bp3-b PE=1 SV=1 305 474 2.0E-07
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 167 467 5.0E-07
sp|O73932|IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis GN=igf2bp3-a PE=1 SV=1 305 474 5.0E-07
sp|Q08CK7|IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio GN=igf2bp1 PE=1 SV=1 305 474 7.0E-07
sp|Q9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1 305 474 2.0E-06
sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 224 474 2.0E-06
sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 294 474 4.0E-06
sp|O42254|IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus GN=IGF2BP1 PE=1 SV=1 305 474 4.0E-06
sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 224 474 4.0E-06
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 294 474 5.0E-06
sp|O88477|IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus GN=Igf2bp1 PE=1 SV=1 305 474 6.0E-06
sp|Q8CGX0|IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus GN=Igf2bp1 PE=1 SV=1 305 474 6.0E-06
sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens GN=IGF2BP1 PE=1 SV=2 305 474 6.0E-06
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 305 470 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2104
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3967
Ophiocordyceps australis map64 (Brazil) OphauB2|2543
Ophiocordyceps camponoti-floridani Ophcf2|04316
Ophiocordyceps camponoti-rufipedis Ophun1|4960 (this protein)
Ophiocordyceps kimflemingae Ophio5|1157
Ophiocordyceps subramaniannii Hirsu2|2480

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4960
MAEPQPDIQSILAALGEIPKLPVSECVLELTVIRAASQRPPHSGPSQTPPGVPGHGYPAPVPSSQAAGYQPPPPS
AAAPPYGAPVHGLPAPAASGNVDLSAIRPVTSGTMNFDDAGSKARPFASDKAPAPPDRPLGYGGDARNNDRSYRR
SRSRSPRAEFNRDERGGGHYGRDRSYSPPPRGRPFSPRGGNGRQRSPLRGADDNSETIQIESSLVGLIIGRQGEN
LRRIETDSKCRVQFLAASDGVPFRQCRISGPRQRRAEVKAAINRIIDDSGMGALNRPQEKPRDANRATGSTSLRD
GEDHMQIMVPDRTVGLIIGRGGETIRDLQERSGCHINIVGESKSVNGLRPVNLIGTVEAAARAKDFIMEIVDSDT
RGDGPAVKKPPVASRAEAPPRDMGGGAQDKANDVIYVPSDAVGMIIGKGGETIRDMQNSTGCKINVAQSSGSGEV
QREIALIGSRESIARAKQAIDEKVDAVRSKSGGGGGGGGGSGGGGGGGGGGGRSRGLPDMDRAAYSQQPSTNQAP
AAAGDASDPYAQYGGYQNYVALWYQSLMYQQQQQQQQGGQGASAGASTGASAGAPAPGAQ*
Coding >Ophun1|4960
ATGGCTGAACCACAACCCGACATTCAAAGCATTCTAGCAGCGCTAGGTGAGATCCCCAAGCTTCCCGTCTCCGAA
TGCGTGCTTGAGCTGACTGTCATTCGCGCAGCTTCTCAGCGACCTCCTCATTCTGGCCCGAGTCAAACACCTCCT
GGCGTCCCAGGCCACGGGTATCCCGCGCCGGTCCCGTCTTCGCAAGCAGCTGGTTACCAGCCGCCACCCCCTTCC
GCCGCCGCACCTCCCTATGGTGCCCCTGTCCACGGTCTGCCTGCGCCTGCGGCCAGCGGAAATGTCGATTTGAGT
GCCATTCGGCCCGTGACCTCTGGCACCATGAACTTTGACGATGCTGGTTCCAAGGCAAGGCCTTTCGCCTCCGAC
AAGGCTCCTGCGCCCCCGGATCGGCCGCTCGGGTATGGCGGTGATGCCAGAAACAACGACCGATCATATCGAAGA
TCAAGATCTCGCTCCCCGAGAGCCGAATTCAATCGGGATGAGCGCGGTGGAGGGCACTACGGACGTGATCGCTCA
TATTCACCCCCTCCTCGCGGCCGGCCCTTCTCCCCGCGTGGAGGCAATGGGCGGCAAAGATCCCCGCTGCGAGGA
GCCGACGACAACTCGGAAACGATACAGATAGAGTCTAGCCTGGTTGGTTTGATTATTGGCCGACAAGGCGAGAAC
CTCCGCCGAATAGAGACCGATTCGAAATGTCGCGTTCAGTTCCTGGCAGCCTCTGACGGTGTTCCCTTCCGGCAG
TGCAGAATCTCAGGTCCGCGCCAACGCCGCGCCGAGGTGAAAGCTGCCATCAACCGCATCATTGATGACAGCGGA
ATGGGCGCCTTGAATCGCCCGCAGGAAAAGCCGAGAGATGCGAATCGTGCCACCGGGTCGACGTCACTGCGAGAC
GGCGAGGATCATATGCAGATCATGGTTCCGGATCGGACGGTGGGACTCATCATTGGCCGTGGCGGTGAAACGATC
CGTGACTTACAGGAACGGTCTGGATGTCACATCAATATTGTCGGAGAGTCAAAAAGCGTCAACGGCTTGCGGCCC
GTCAACCTGATAGGGACGGTCGAGGCTGCTGCCCGAGCCAAGGATTTCATCATGGAGATTGTCGACAGTGATACT
CGTGGCGACGGTCCCGCGGTGAAGAAGCCTCCCGTCGCCAGCCGAGCTGAGGCGCCGCCGAGGGACATGGGCGGA
GGCGCGCAGGACAAGGCCAACGACGTCATCTACGTCCCGTCCGACGCAGTAGGCATGATCATCGGCAAGGGAGGC
GAAACCATACGGGATATGCAGAACAGTACTGGGTGCAAGATTAACGTGGCACAATCGTCCGGGTCTGGTGAGGTG
CAGCGAGAGATTGCTTTGATCGGCTCGCGCGAGAGTATTGCTCGGGCGAAGCAGGCCATTGACGAGAAGGTGGAT
GCCGTGAGATCAAAGAGCGGCGGCGGAGGAGGAGGTGGAGGAGGAAGTGGAGGAGGAGGAGGAGGGGGAGGAGGA
GGCGGCCGGAGCCGTGGCCTCCCCGACATGGACCGGGCTGCCTACTCGCAGCAGCCGTCGACTAACCAAGCGCCG
GCAGCAGCAGGCGATGCGTCCGACCCCTACGCCCAATACGGCGGATACCAAAACTACGTGGCGCTCTGGTACCAG
TCGCTGATGTACCAGCAGCAGCAGCAGCAGCAACAGGGCGGACAAGGAGCGTCGGCCGGAGCATCGACCGGAGCA
TCGGCCGGAGCGCCGGCGCCGGGAGCTCAGTGA
Transcript >Ophun1|4960
ATGGCTGAACCACAACCCGACATTCAAAGCATTCTAGCAGCGCTAGGTGAGATCCCCAAGCTTCCCGTCTCCGAA
TGCGTGCTTGAGCTGACTGTCATTCGCGCAGCTTCTCAGCGACCTCCTCATTCTGGCCCGAGTCAAACACCTCCT
GGCGTCCCAGGCCACGGGTATCCCGCGCCGGTCCCGTCTTCGCAAGCAGCTGGTTACCAGCCGCCACCCCCTTCC
GCCGCCGCACCTCCCTATGGTGCCCCTGTCCACGGTCTGCCTGCGCCTGCGGCCAGCGGAAATGTCGATTTGAGT
GCCATTCGGCCCGTGACCTCTGGCACCATGAACTTTGACGATGCTGGTTCCAAGGCAAGGCCTTTCGCCTCCGAC
AAGGCTCCTGCGCCCCCGGATCGGCCGCTCGGGTATGGCGGTGATGCCAGAAACAACGACCGATCATATCGAAGA
TCAAGATCTCGCTCCCCGAGAGCCGAATTCAATCGGGATGAGCGCGGTGGAGGGCACTACGGACGTGATCGCTCA
TATTCACCCCCTCCTCGCGGCCGGCCCTTCTCCCCGCGTGGAGGCAATGGGCGGCAAAGATCCCCGCTGCGAGGA
GCCGACGACAACTCGGAAACGATACAGATAGAGTCTAGCCTGGTTGGTTTGATTATTGGCCGACAAGGCGAGAAC
CTCCGCCGAATAGAGACCGATTCGAAATGTCGCGTTCAGTTCCTGGCAGCCTCTGACGGTGTTCCCTTCCGGCAG
TGCAGAATCTCAGGTCCGCGCCAACGCCGCGCCGAGGTGAAAGCTGCCATCAACCGCATCATTGATGACAGCGGA
ATGGGCGCCTTGAATCGCCCGCAGGAAAAGCCGAGAGATGCGAATCGTGCCACCGGGTCGACGTCACTGCGAGAC
GGCGAGGATCATATGCAGATCATGGTTCCGGATCGGACGGTGGGACTCATCATTGGCCGTGGCGGTGAAACGATC
CGTGACTTACAGGAACGGTCTGGATGTCACATCAATATTGTCGGAGAGTCAAAAAGCGTCAACGGCTTGCGGCCC
GTCAACCTGATAGGGACGGTCGAGGCTGCTGCCCGAGCCAAGGATTTCATCATGGAGATTGTCGACAGTGATACT
CGTGGCGACGGTCCCGCGGTGAAGAAGCCTCCCGTCGCCAGCCGAGCTGAGGCGCCGCCGAGGGACATGGGCGGA
GGCGCGCAGGACAAGGCCAACGACGTCATCTACGTCCCGTCCGACGCAGTAGGCATGATCATCGGCAAGGGAGGC
GAAACCATACGGGATATGCAGAACAGTACTGGGTGCAAGATTAACGTGGCACAATCGTCCGGGTCTGGTGAGGTG
CAGCGAGAGATTGCTTTGATCGGCTCGCGCGAGAGTATTGCTCGGGCGAAGCAGGCCATTGACGAGAAGGTGGAT
GCCGTGAGATCAAAGAGCGGCGGCGGAGGAGGAGGTGGAGGAGGAAGTGGAGGAGGAGGAGGAGGGGGAGGAGGA
GGCGGCCGGAGCCGTGGCCTCCCCGACATGGACCGGGCTGCCTACTCGCAGCAGCCGTCGACTAACCAAGCGCCG
GCAGCAGCAGGCGATGCGTCCGACCCCTACGCCCAATACGGCGGATACCAAAACTACGTGGCGCTCTGGTACCAG
TCGCTGATGTACCAGCAGCAGCAGCAGCAGCAACAGGGCGGACAAGGAGCGTCGGCCGGAGCATCGACCGGAGCA
TCGGCCGGAGCGCCGGCGCCGGGAGCTCAGTGA
Gene >Ophun1|4960
ATGGCTGAACCACAACCCGACATTCAAAGCATTCTAGCAGCGCTAGGTGAGATCCCCAAGCTTCCCGTCTCCGAA
TGCGTGCTTGAGCTGACTGTCATTCGCGCAGCTTCTCAGCGACCTCCTCATTCTGGCCCGAGTCAAACACCTCCT
GGCGTCCCAGGCCACGGGTATCCCGCGCCGGTCCCGTCTTCGCAAGCAGCTGGTTACCAGCCGCCACCCCCTTCC
GCCGCCGCACCTCCCTATGGTGCCCCTGTCCACGGTCTGCCTGCGCCTGCGGCCAGCGGAAATGTCGATTTGAGT
GCCATTCGGCCCGTGACCTCTGGCACCATGAACTTTGACGATGCTGGTTCCAAGGCAAGGCCTTTCGCCTCCGAC
AAGGCTCCTGCGCCCCCGGATCGGCCGCTCGGGTATGGCGGTGATGCCAGAAACAACGACCGATCATATCGAAGA
TCAAGATCTCGCTCCCCGAGAGCCGAATTCAATCGGGATGAGCGCGGTGGAGGGCACTACGGACGTGATCGCTCA
TATTCACCCCCTCCTCGCGGCCGGCCCTTCTCCCCGCGTGGAGGCAATGGGCGGCAAAGATCCCCGCTGCGAGGA
GCCGACGACAACTCGGAAACGATACAGATAGAGTCTAGCCTGGTTGGTTTGATTATTGGCCGACAAGGCGAGAAC
CTCCGCCGAATAGAGACCGATTCGAAATGTCGCGTTCAGTTCCTGGCAGCCTCTGACGGTGTTCCCTTCCGGCAG
TGCAGAATCTCAGGTCCGCGCCAACGCCGCGCCGAGGTGAAAGCTGCCATCAACCGCATCATTGATGACAGCGGA
ATGGGCGCCTTGAATCGCCCGCAGGAAAAGCCGAGAGATGCGAATCGTGCCACCGGGTCGACGTCACTGCGAGAC
GGCGAGGATCATATGCAGATCATGGTTCCGGATCGGACGGTGGGACTCATCATTGGCCGTGGCGGTGAAACGATC
CGTGACTTACAGGAACGGTCTGGATGTCACATCAATATTGTCGGAGAGTCAAAAAGCGTCAACGGCTTGCGGCCC
GTCAACCTGATAGGGACGGTCGAGGCTGCTGCCCGAGCCAAGGATTTCATCATGGAGATTGTCGACAGTGATACT
CGTGGCGACGGTCCCGCGGTGAAGAAGCCTCCCGTCGCCAGCCGAGCTGAGGCGCCGCCGAGGGACATGGGCGGA
GGCGCGCAGGACAAGGCCAACGACGTCATCTACGTCCCGTCCGACGCAGTAGGCATGATCATCGGCAAGGGAGGC
GAAACCATACGGGATATGCAGAACAGTACTGGGTGCAAGATTAACGTGGCACAATCGTCCGGGTCTGGTGAGGTG
CAGCGAGAGATTGCTTTGATCGGCTCGCGCGAGAGTATTGCTCGGGCGAAGCAGGCCATTGACGAGAAGGTGGAT
GCCGTGGTATGTTGCTACGCTCCTCATGAGCTGTGGACCGTGCTTACGAAAACGTTGCAGAGATCAAAGAGCGGC
GGCGGAGGAGGAGGTGGAGGAGGAAGTGGAGGAGGAGGAGGAGGGGGAGGAGGAGGCGGCCGGAGCCGTGGCCTC
CCCGACATGGACCGGGCTGCCTACTCGCAGCAGCCGTCGACTAACCAAGCGCCGGCAGCAGCAGGCGATGCGTCC
GACCCCTACGCCCAATGTGAGTCCCCGCTGGTGAAGGAGATGGCCTACGACGAGCTAACGGATCGTCGCAGACGG
CGGATACCAAAACTACGTGGCGCTCTGGTACCAGTCGCTGATGTACCAGCAGCAGCAGCAGCAGCAACAGGGCGG
ACAAGGAGCGTCGGCCGGAGCATCGACCGGAGCATCGGCCGGAGCGCCGGCGCCGGGAGCTCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail