Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4958
Gene name
LocationContig_471:2779..4211
Strand-
Gene length (bp)1432
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 6.9E-31 110 432

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 110 432 3.0E-47
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 158 430 1.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 158 426 8.0E-14
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 158 426 2.0E-12
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 110 432 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 110 432 3.0E-47
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 158 430 1.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 158 426 8.0E-14
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 158 426 2.0E-12
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 110 432 1.0E-11
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 158 432 3.0E-11
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 158 432 6.0E-11
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 105 431 8.0E-11
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 110 432 2.0E-10
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 62 435 4.0E-10
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 64 432 5.0E-10
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 67 435 7.0E-10
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 158 432 7.0E-10
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 159 432 1.0E-09
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 159 424 2.0E-09
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 78 425 2.0E-09
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 155 430 4.0E-09
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 157 430 4.0E-09
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 110 432 6.0E-09
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 155 432 9.0E-09
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 110 432 1.0E-08
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 159 432 2.0E-08
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 157 430 3.0E-08
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 158 426 3.0E-08
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 155 432 4.0E-08
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 96 432 7.0E-08
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 32 432 7.0E-08
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 30 435 9.0E-08
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 30 435 9.0E-08
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 26 426 4.0E-07
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 53 432 4.0E-07
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 157 424 5.0E-07
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 158 426 5.0E-07
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 159 430 7.0E-07
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 159 424 1.0E-06
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 111 435 1.0E-06
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 26 426 1.0E-06
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 96 432 2.0E-06
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 26 426 2.0E-06
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 158 430 2.0E-06
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 110 435 2.0E-06
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 155 430 3.0E-06
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 1 432 5.0E-06
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 1 432 5.0E-06
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 158 430 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999493

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3971
Ophiocordyceps australis map64 (Brazil) OphauB2|2540
Ophiocordyceps camponoti-floridani Ophcf2|04314
Ophiocordyceps camponoti-rufipedis Ophun1|4958 (this protein)
Ophiocordyceps kimflemingae Ophio5|1155
Ophiocordyceps subramaniannii Hirsu2|1353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4958
MKVARSLLALVGGCLGLCWASAVDFSQPMHGLKLQQIKATRAATTDRTASHFSRLQHISNSEHPSTLSRALAVRT
PPSRHDNVYQNITRAGIYSTQYAIDCSWDGTPTWLLLDTGSADTWSVRSDYTCEDGLGGTVGCGFGWPLIEDFGG
GTIPDLHFSLRYGSGERVRGPMGFSDLVCGGLLVTKQQVGLANYTYWHGNNLTVGILGLAYPSITSAYYGDYGAE
APWNAISYTPFLTSAILQGAMDPVFSVALIKNSTDGLIAWGGLPPVDWRQGKTATTDLIIANLIDQAETSWRYSF
YTIIPDGIRWGQTTDTTKFPYIVDTGTTMNYLPPPLAEAIANAFQPRAVYLYQWGSYFAPCHSVPPPVSVVISGV
EFSINAADLIYQDLRDPLTGYCAVAIASGGTGPYILGDVFLQNVVAVFDVGAAQMRFYSR*
Coding >Ophun1|4958
ATGAAGGTGGCTCGGTCTCTGCTGGCTCTGGTGGGAGGATGTCTGGGCCTGTGCTGGGCCTCGGCAGTCGACTTC
TCGCAGCCCATGCACGGACTCAAGCTGCAGCAGATCAAGGCGACGCGAGCGGCGACCACGGACCGAACGGCGTCG
CACTTTTCGCGGCTTCAGCATATCAGCAACAGCGAGCATCCGTCGACGCTTAGCCGGGCTCTCGCGGTGAGGACG
CCTCCCTCGCGGCACGACAACGTGTACCAGAATATCACGCGGGCCGGCATCTATTCGACGCAGTATGCCATCGAC
TGCAGCTGGGATGGGACGCCCACCTGGTTGCTGCTCGACACGGGGAGCGCCGATACGTGGTCGGTGCGGTCCGAC
TACACCTGTGAAGACGGGCTCGGGGGCACCGTTGGCTGTGGCTTCGGATGGCCGCTCATCGAGGACTTTGGTGGA
GGTACCATCCCGGATCTGCACTTTTCGCTACGATACGGCTCCGGCGAGAGGGTCAGGGGGCCGATGGGATTCAGC
GATCTTGTCTGCGGAGGGCTGCTGGTGACGAAGCAGCAGGTCGGGCTGGCCAACTACACGTACTGGCACGGCAAT
AACCTGACGGTCGGGATCCTGGGACTGGCGTATCCGTCCATCACGAGCGCCTACTACGGGGACTATGGGGCCGAG
GCACCGTGGAACGCCATCTCGTACACGCCGTTTTTGACGAGCGCCATCTTGCAGGGAGCTATGGATCCGGTCTTT
AGCGTTGCGCTCATCAAGAATTCAACCGATGGCCTCATCGCTTGGGGGGGGTTACCGCCGGTGGACTGGCGGCAG
GGGAAGACGGCGACGACGGATCTGATTATCGCCAACCTCATCGATCAGGCCGAGACGTCGTGGCGATACTCGTTT
TACACCATTATCCCGGACGGCATCAGATGGGGTCAGACGACGGACACGACCAAGTTCCCGTACATTGTGGACACG
GGCACGACGATGAACTATCTGCCTCCGCCCCTGGCCGAGGCCATCGCCAACGCGTTCCAGCCGCGAGCCGTGTAC
CTGTACCAATGGGGCTCGTACTTTGCGCCGTGCCACTCGGTGCCGCCGCCGGTGTCGGTGGTGATTTCGGGCGTC
GAGTTTAGCATCAACGCGGCGGATCTGATATATCAGGACCTGCGGGATCCGTTGACGGGTTACTGCGCCGTGGCT
ATTGCCAGCGGGGGGACGGGGCCGTATATCCTGGGAGATGTGTTCCTGCAGAATGTGGTGGCGGTGTTTGATGTT
GGGGCGGCGCAGATGCGGTTCTACTCGCGGTGA
Transcript >Ophun1|4958
ATGAAGGTGGCTCGGTCTCTGCTGGCTCTGGTGGGAGGATGTCTGGGCCTGTGCTGGGCCTCGGCAGTCGACTTC
TCGCAGCCCATGCACGGACTCAAGCTGCAGCAGATCAAGGCGACGCGAGCGGCGACCACGGACCGAACGGCGTCG
CACTTTTCGCGGCTTCAGCATATCAGCAACAGCGAGCATCCGTCGACGCTTAGCCGGGCTCTCGCGGTGAGGACG
CCTCCCTCGCGGCACGACAACGTGTACCAGAATATCACGCGGGCCGGCATCTATTCGACGCAGTATGCCATCGAC
TGCAGCTGGGATGGGACGCCCACCTGGTTGCTGCTCGACACGGGGAGCGCCGATACGTGGTCGGTGCGGTCCGAC
TACACCTGTGAAGACGGGCTCGGGGGCACCGTTGGCTGTGGCTTCGGATGGCCGCTCATCGAGGACTTTGGTGGA
GGTACCATCCCGGATCTGCACTTTTCGCTACGATACGGCTCCGGCGAGAGGGTCAGGGGGCCGATGGGATTCAGC
GATCTTGTCTGCGGAGGGCTGCTGGTGACGAAGCAGCAGGTCGGGCTGGCCAACTACACGTACTGGCACGGCAAT
AACCTGACGGTCGGGATCCTGGGACTGGCGTATCCGTCCATCACGAGCGCCTACTACGGGGACTATGGGGCCGAG
GCACCGTGGAACGCCATCTCGTACACGCCGTTTTTGACGAGCGCCATCTTGCAGGGAGCTATGGATCCGGTCTTT
AGCGTTGCGCTCATCAAGAATTCAACCGATGGCCTCATCGCTTGGGGGGGGTTACCGCCGGTGGACTGGCGGCAG
GGGAAGACGGCGACGACGGATCTGATTATCGCCAACCTCATCGATCAGGCCGAGACGTCGTGGCGATACTCGTTT
TACACCATTATCCCGGACGGCATCAGATGGGGTCAGACGACGGACACGACCAAGTTCCCGTACATTGTGGACACG
GGCACGACGATGAACTATCTGCCTCCGCCCCTGGCCGAGGCCATCGCCAACGCGTTCCAGCCGCGAGCCGTGTAC
CTGTACCAATGGGGCTCGTACTTTGCGCCGTGCCACTCGGTGCCGCCGCCGGTGTCGGTGGTGATTTCGGGCGTC
GAGTTTAGCATCAACGCGGCGGATCTGATATATCAGGACCTGCGGGATCCGTTGACGGGTTACTGCGCCGTGGCT
ATTGCCAGCGGGGGGACGGGGCCGTATATCCTGGGAGATGTGTTCCTGCAGAATGTGGTGGCGGTGTTTGATGTT
GGGGCGGCGCAGATGCGGTTCTACTCGCGGTGA
Gene >Ophun1|4958
ATGAAGGTGGCTCGGTCTCTGCTGGCTCTGGTGGGAGGATGTCTGGGCCTGTGCTGGGCCTCGGCAGTCGACTTC
TCGCAGCCCATGCACGGACTCAAGCTGCAGCAGATCAAGGCGACGCGAGCGGCGACCACGGACCGAACGGCGTCG
CACTTTTCGCGGCTTCAGCATATCAGCAACAGCGAGCATCCGTCGACGCTTAGCCGGGCTCTCGCGGTGAGGACG
CCTCCCTCGCGGCACGACAACGTGTACCAGAATATCACGCGGGCCGGCATCTATTCGACGCAGTATGCCATCGAC
TGCAGCTGGGATGGGACGCCCACCTGGTTGCTGCTCGACACGGGGAGCGCCGATACGTGGTCGGTGCGGTCCGAC
TACACCTGTGAAGACGGGCTCGGGGGCACCGTTGGCTGTGGCTTCGGATGGCCGCTCATCGAGGACTTTGGTGGA
GGTACCATCCCGGATCTGCACTTTTCGCTACGATACGGCTCCGGCGAGAGGGTCAGGGGGCCGATGGGATTCAGC
GATCTTGTCTGCGGAGGGCTGCTGGTGACGAAGCAGCAGGTCGGGCTGGCCAACTACACGTACTGGCACGGCAAT
AACCTGACGGTCGGGATCCTGGGACTGGCGTATCCGTCCATCACGAGCGCCTACTACGGGGACTATGGGGCCGAG
GCACCGTGGAACGCCATCTCGTACACGCCGTTTTTGACGAGCGCCATCTTGCAGGGAGCTATGGATCCGGTCTTT
AGCGTTGCGCTCATCAAGAATTCAACCGATGGCCTCATCGCTTGGGGGGGGTTACCGCCGGTGGACTGGCGGCAG
GGGAAGACGGCGACGACGGATCTGATTATCGTCAGTTGAGAGCGGGATCCGTATTGGATGTGAGCTGACTGGCGT
GGCAGGCCAACCTCATCGATCAGGCCGAGACGTCGTGGCGATACTCGTTTTACACCATTATCCCGGACGGCATCA
GATGGGGTCAGACGACGGACACGACCAAGTTCCCGTACATTGTGGACACGGGCACGACGATGAACTATCTGCCTC
CGCGTGGGTTTTTCCCCCCCTTGACACGTGGGAGGGAGAGATAACGGGAGAGAGACAAGGGGGCTAACGATCAAC
AGCCCTGGCCGAGGCCATCGCCAACGCGTTCCAGCCGCGAGCCGTGTACCTGTACCAATGGGGCTCGTACTTTGC
GCCGTGCCACTCGGTGCCGCCGCCGGTGTCGGTGGTGATTTCGGGCGTCGAGTTTAGCATCAACGCGGCGGATCT
GATATATCAGGACCTGCGGGATCCGTTGACGGGTTACTGCGCCGTGGCTATTGCCAGCGGGGGGACGGGGCCGTA
TATCCTGGGAGATGTGTTCCTGCAGAATGTGGTGGCGGTGTTTGATGTTGGGGCGGCGCAGATGCGGTTCTACTC
GCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail