Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4955
Gene name
LocationContig_470:7253..11148
Strand-
Gene length (bp)3895
Transcript length (bp)3216
Coding sequence length (bp)3216
Protein length (aa) 1072

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02891 zf-MIZ MIZ/SP-RING zinc finger 8.7E-10 937 990

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 880 1035 6.0E-14
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 818 1037 8.0E-13
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 818 1045 1.0E-12
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 870 1033 4.0E-12
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 751 1034 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 880 1035 6.0E-14
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 818 1037 8.0E-13
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 818 1045 1.0E-12
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 870 1033 4.0E-12
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 751 1034 3.0E-11
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 751 1034 4.0E-11
sp|Q6ASW7|SIZ2_ORYSJ E3 SUMO-protein ligase SIZ2 OS=Oryza sativa subsp. japonica GN=SIZ2 PE=2 SV=1 820 1031 8.0E-10
sp|Q680Q4|SIZ1_ARATH E3 SUMO-protein ligase SIZ1 OS=Arabidopsis thaliana GN=SIZ1 PE=1 SV=2 820 1031 2.0E-09
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 868 1045 2.0E-09
sp|O54714|PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus GN=Pias3 PE=1 SV=3 761 1064 4.0E-09
sp|O70260|PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus GN=Pias3 PE=1 SV=2 761 1053 7.0E-09
sp|Q9JM05|PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus GN=Pias4 PE=1 SV=2 846 1064 5.0E-08
sp|Q8N2W9|PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens GN=PIAS4 PE=1 SV=1 846 1043 1.0E-07
sp|Q6L4L4|SIZ1_ORYSJ E3 SUMO-protein ligase SIZ1 OS=Oryza sativa subsp. japonica GN=SIZ1 PE=1 SV=1 820 1031 3.0E-07
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 877 1035 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5303
Ophiocordyceps australis map64 (Brazil) OphauB2|3841
Ophiocordyceps camponoti-floridani Ophcf2|00931
Ophiocordyceps camponoti-floridani Ophcf2|00932
Ophiocordyceps camponoti-rufipedis Ophun1|4955 (this protein)
Ophiocordyceps kimflemingae Ophio5|5282
Ophiocordyceps subramaniannii Hirsu2|2359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4955
MLIAGRDPQLLEASENKLGHLILYQRSTVKTASRVDGQAALILQPQLASQPLSSIAADAWPIPDSPYMPASKRRP
RSEAVHEAARPPLDASNETSRAFLGVQRRAWMTTTGSDSPIVARAKPHAPTRRPELPVIPPVNPSAVVSPPPSVT
SILPSPVNSSISSPEVSTLGPAPAGNPETVDAPPPGLAMAGSPPTAQVPSPPSFDPLSSTEADPCLVPAASRHLA
PTQQDMTAEFTELALVPVSTQSDATPAAETYPTPQHQPPPTASLSHGTFVAAPQQNYVRPRDVQPDRQPKRHCSE
ASRRPLVTQSAFGGYAVDFDQLLALVENHVRQLGSALRGDVIAYRLLASACSKGDFFFLVLHQAYCLWSLSSQMA
CWLLDAQPDVVDTAFHQLQWSWRRNSDLSPYHLRWFASFPLLTTRNSSAMRLPKLMATNLIPAINNFLVLLGQNW
NLLLEQVVHRGYPLMAWEMNNLLQCSSSVLRSILFICSRRPFGVFEGSSLTNALSQLFDLDFCNEASGHVDSPDV
VNMRMVIRDRYIAMMQQGRGNQYFPVLGSNANMSAAQRPAQPHLVPFGFSGSPSVPGGGQTGGVFTSPAMPNMTP
SQPAPYFPRIQQPQMLPTTQRPMPAVQNRVPQTTATAGLTSARGPVPHPQPQHTGSQAMQPALTWPSAVQPRPGP
QHAIVRTQTTPRSRGATASQHRVVPLGDHEIPREEWTRAQHGLHLSSLRSPKLICASPSGSRFYQFMTHFAVAPQ
ALPPQPGLRDFRFSLSEEQVSMLVRADTKTHATNVPFHNRSLRCRLRLCKQGQAVEHVPEATWTGCPTYWPPHIF
LECNEQSLQLRRRQHFQNDLPIELTGLLRSGENTIRVSLPRVGPNIDKVSTYFIGVEMIETLDHETVLAMVEENP
RTSIEETKQKVCQRLKPDGSDDIIAEGDHICVAVTDPFSSSLFEIPVRGADCKHWECFDLDIWLRTRRGKRSGDT
GEPTVPDCWKCPVCDLDARPVRLRIDEFFTDVRAKLIKNGEERIKKISIQFDGSWRPLPEPDEAEDEKQPPATSG
QSGPPQVAASETAQVIIIDDD*
Coding >Ophun1|4955
ATGCTCATTGCGGGTCGGGACCCTCAGCTTCTGGAAGCCTCTGAAAACAAGCTCGGTCACCTCATCCTCTACCAG
CGGTCAACGGTCAAGACTGCCTCCCGCGTCGACGGCCAAGCGGCTTTAATCCTCCAGCCCCAGCTCGCAAGTCAG
CCCCTGTCGTCGATAGCAGCAGACGCATGGCCCATCCCAGACTCGCCATACATGCCAGCCTCGAAGCGTCGTCCT
CGCTCAGAGGCCGTCCATGAGGCGGCTCGTCCGCCCCTCGACGCTAGCAATGAGACATCGCGAGCCTTTCTCGGC
GTGCAACGCCGTGCGTGGATGACGACGACTGGTTCAGACTCGCCGATCGTCGCCCGCGCAAAGCCTCACGCGCCG
ACGCGTCGCCCTGAACTGCCTGTCATACCGCCTGTCAATCCTTCTGCCGTCGTCAGCCCCCCGCCGAGTGTTACT
TCAATCCTCCCATCGCCCGTCAACTCGAGCATCTCGAGCCCCGAGGTCTCTACCTTGGGGCCGGCTCCGGCTGGC
AACCCCGAGACGGTCGATGCGCCGCCTCCGGGCCTCGCCATGGCTGGCTCTCCGCCGACGGCCCAGGTCCCGAGC
CCTCCGTCGTTTGACCCTCTTTCGTCCACCGAAGCCGACCCGTGTCTTGTCCCGGCTGCATCGCGCCACCTCGCT
CCTACGCAGCAAGACATGACAGCCGAGTTCACCGAGCTTGCTCTGGTGCCCGTATCGACCCAGTCAGACGCAACC
CCCGCTGCCGAAACCTACCCGACGCCTCAACACCAGCCACCTCCTACCGCGTCACTTTCACACGGCACTTTCGTC
GCCGCGCCCCAGCAGAACTACGTTCGGCCGAGAGACGTACAACCAGACAGACAGCCGAAGCGACATTGCTCCGAG
GCTTCGCGACGGCCTTTGGTTACCCAGTCCGCCTTCGGGGGCTATGCCGTCGACTTTGATCAGTTGCTGGCCCTC
GTCGAGAATCATGTGCGACAATTGGGAAGCGCCCTCCGCGGTGATGTCATCGCCTATCGGCTGCTGGCGTCGGCT
TGCTCCAAGGGGGATTTCTTCTTCCTTGTCCTGCATCAAGCATACTGTCTGTGGTCGTTGAGCAGTCAGATGGCA
TGTTGGCTGCTCGATGCCCAGCCGGACGTCGTCGATACGGCATTCCACCAACTGCAATGGTCATGGAGGCGAAAC
TCGGATTTATCGCCCTACCACCTTCGCTGGTTTGCCTCGTTTCCTCTCTTGACAACGAGAAACTCAAGTGCCATG
CGCCTCCCCAAACTCATGGCCACCAACCTCATACCCGCCATCAATAATTTCCTCGTCTTGTTGGGGCAGAATTGG
AACCTCCTGCTGGAACAAGTCGTCCACAGGGGCTACCCGCTAATGGCATGGGAGATGAATAACCTTTTGCAATGC
TCATCGTCTGTGCTGCGATCAATCCTCTTCATCTGCAGTCGTCGACCCTTTGGTGTTTTTGAGGGAAGTTCCTTG
ACGAATGCCTTGTCCCAGCTGTTTGACCTGGATTTCTGCAATGAAGCTTCGGGACACGTCGACTCGCCCGATGTG
GTCAACATGCGGATGGTAATCAGGGATAGGTATATTGCCATGATGCAACAAGGCAGAGGCAACCAATACTTCCCA
GTATTGGGGAGCAATGCCAACATGAGTGCTGCTCAAAGGCCGGCTCAGCCTCATCTGGTACCATTCGGTTTCTCC
GGCTCGCCGTCAGTCCCTGGCGGCGGGCAGACGGGCGGTGTCTTCACATCGCCTGCGATGCCCAACATGACTCCT
TCTCAGCCTGCGCCATATTTCCCTCGAATTCAACAGCCACAGATGTTGCCAACGACGCAGCGTCCGATGCCGGCG
GTTCAGAACCGCGTCCCGCAAACGACGGCAACGGCGGGTCTTACTTCTGCCCGAGGCCCGGTCCCCCATCCACAG
CCGCAGCACACCGGCTCTCAGGCTATGCAGCCTGCATTGACGTGGCCCAGCGCCGTCCAGCCTCGTCCGGGTCCT
CAACACGCCATTGTGCGGACACAGACTACACCGCGGTCACGAGGCGCAACGGCTAGCCAGCATCGAGTCGTTCCG
CTAGGGGATCATGAAATTCCTCGAGAAGAGTGGACGCGTGCCCAACATGGCCTGCACTTGTCGTCTCTGCGCAGC
CCCAAGTTGATTTGCGCGAGTCCCTCTGGCAGTCGCTTTTACCAGTTTATGACGCACTTCGCTGTAGCGCCGCAA
GCCCTGCCTCCTCAGCCTGGCCTGAGAGATTTCCGCTTTTCTCTATCGGAGGAACAAGTGTCCATGTTGGTCAGA
GCGGACACCAAGACTCATGCGACCAATGTTCCGTTTCACAATCGATCTCTTCGCTGTCGCCTTCGTCTGTGCAAA
CAAGGACAAGCTGTCGAGCACGTGCCAGAGGCAACCTGGACTGGCTGTCCGACATACTGGCCACCTCACATATTC
CTGGAATGCAATGAGCAGTCTCTGCAGCTGCGGCGACGTCAACACTTCCAGAATGATCTTCCGATAGAGCTGACT
GGCCTGTTACGGTCTGGGGAAAACACAATTCGCGTCAGTCTGCCTCGGGTCGGGCCCAACATCGACAAGGTGTCG
ACGTACTTCATCGGTGTCGAGATGATTGAGACCTTGGACCACGAGACCGTACTTGCCATGGTCGAGGAGAACCCC
AGGACCAGCATCGAAGAGACCAAGCAGAAGGTATGCCAGAGACTGAAGCCGGATGGCTCGGACGACATCATTGCC
GAGGGCGACCACATTTGTGTGGCAGTGACGGATCCTTTCAGTTCCTCCCTCTTCGAGATTCCCGTTCGAGGAGCC
GACTGCAAGCATTGGGAGTGCTTCGATCTGGACATCTGGCTGCGGACGCGCCGCGGAAAGCGATCCGGCGACACT
GGAGAACCGACCGTGCCGGATTGTTGGAAATGCCCCGTCTGCGATCTGGACGCGAGGCCCGTCCGCCTTCGTATC
GACGAGTTCTTTACCGACGTTCGGGCCAAGCTCATCAAGAACGGGGAAGAGAGAATAAAAAAGATATCTATCCAG
TTTGATGGTTCCTGGCGTCCGCTGCCGGAACCGGACGAGGCCGAAGATGAGAAACAGCCGCCCGCCACGAGTGGC
CAATCCGGGCCCCCACAGGTTGCAGCCTCGGAGACCGCGCAAGTGATAATTATTGACGACGACTAG
Transcript >Ophun1|4955
ATGCTCATTGCGGGTCGGGACCCTCAGCTTCTGGAAGCCTCTGAAAACAAGCTCGGTCACCTCATCCTCTACCAG
CGGTCAACGGTCAAGACTGCCTCCCGCGTCGACGGCCAAGCGGCTTTAATCCTCCAGCCCCAGCTCGCAAGTCAG
CCCCTGTCGTCGATAGCAGCAGACGCATGGCCCATCCCAGACTCGCCATACATGCCAGCCTCGAAGCGTCGTCCT
CGCTCAGAGGCCGTCCATGAGGCGGCTCGTCCGCCCCTCGACGCTAGCAATGAGACATCGCGAGCCTTTCTCGGC
GTGCAACGCCGTGCGTGGATGACGACGACTGGTTCAGACTCGCCGATCGTCGCCCGCGCAAAGCCTCACGCGCCG
ACGCGTCGCCCTGAACTGCCTGTCATACCGCCTGTCAATCCTTCTGCCGTCGTCAGCCCCCCGCCGAGTGTTACT
TCAATCCTCCCATCGCCCGTCAACTCGAGCATCTCGAGCCCCGAGGTCTCTACCTTGGGGCCGGCTCCGGCTGGC
AACCCCGAGACGGTCGATGCGCCGCCTCCGGGCCTCGCCATGGCTGGCTCTCCGCCGACGGCCCAGGTCCCGAGC
CCTCCGTCGTTTGACCCTCTTTCGTCCACCGAAGCCGACCCGTGTCTTGTCCCGGCTGCATCGCGCCACCTCGCT
CCTACGCAGCAAGACATGACAGCCGAGTTCACCGAGCTTGCTCTGGTGCCCGTATCGACCCAGTCAGACGCAACC
CCCGCTGCCGAAACCTACCCGACGCCTCAACACCAGCCACCTCCTACCGCGTCACTTTCACACGGCACTTTCGTC
GCCGCGCCCCAGCAGAACTACGTTCGGCCGAGAGACGTACAACCAGACAGACAGCCGAAGCGACATTGCTCCGAG
GCTTCGCGACGGCCTTTGGTTACCCAGTCCGCCTTCGGGGGCTATGCCGTCGACTTTGATCAGTTGCTGGCCCTC
GTCGAGAATCATGTGCGACAATTGGGAAGCGCCCTCCGCGGTGATGTCATCGCCTATCGGCTGCTGGCGTCGGCT
TGCTCCAAGGGGGATTTCTTCTTCCTTGTCCTGCATCAAGCATACTGTCTGTGGTCGTTGAGCAGTCAGATGGCA
TGTTGGCTGCTCGATGCCCAGCCGGACGTCGTCGATACGGCATTCCACCAACTGCAATGGTCATGGAGGCGAAAC
TCGGATTTATCGCCCTACCACCTTCGCTGGTTTGCCTCGTTTCCTCTCTTGACAACGAGAAACTCAAGTGCCATG
CGCCTCCCCAAACTCATGGCCACCAACCTCATACCCGCCATCAATAATTTCCTCGTCTTGTTGGGGCAGAATTGG
AACCTCCTGCTGGAACAAGTCGTCCACAGGGGCTACCCGCTAATGGCATGGGAGATGAATAACCTTTTGCAATGC
TCATCGTCTGTGCTGCGATCAATCCTCTTCATCTGCAGTCGTCGACCCTTTGGTGTTTTTGAGGGAAGTTCCTTG
ACGAATGCCTTGTCCCAGCTGTTTGACCTGGATTTCTGCAATGAAGCTTCGGGACACGTCGACTCGCCCGATGTG
GTCAACATGCGGATGGTAATCAGGGATAGGTATATTGCCATGATGCAACAAGGCAGAGGCAACCAATACTTCCCA
GTATTGGGGAGCAATGCCAACATGAGTGCTGCTCAAAGGCCGGCTCAGCCTCATCTGGTACCATTCGGTTTCTCC
GGCTCGCCGTCAGTCCCTGGCGGCGGGCAGACGGGCGGTGTCTTCACATCGCCTGCGATGCCCAACATGACTCCT
TCTCAGCCTGCGCCATATTTCCCTCGAATTCAACAGCCACAGATGTTGCCAACGACGCAGCGTCCGATGCCGGCG
GTTCAGAACCGCGTCCCGCAAACGACGGCAACGGCGGGTCTTACTTCTGCCCGAGGCCCGGTCCCCCATCCACAG
CCGCAGCACACCGGCTCTCAGGCTATGCAGCCTGCATTGACGTGGCCCAGCGCCGTCCAGCCTCGTCCGGGTCCT
CAACACGCCATTGTGCGGACACAGACTACACCGCGGTCACGAGGCGCAACGGCTAGCCAGCATCGAGTCGTTCCG
CTAGGGGATCATGAAATTCCTCGAGAAGAGTGGACGCGTGCCCAACATGGCCTGCACTTGTCGTCTCTGCGCAGC
CCCAAGTTGATTTGCGCGAGTCCCTCTGGCAGTCGCTTTTACCAGTTTATGACGCACTTCGCTGTAGCGCCGCAA
GCCCTGCCTCCTCAGCCTGGCCTGAGAGATTTCCGCTTTTCTCTATCGGAGGAACAAGTGTCCATGTTGGTCAGA
GCGGACACCAAGACTCATGCGACCAATGTTCCGTTTCACAATCGATCTCTTCGCTGTCGCCTTCGTCTGTGCAAA
CAAGGACAAGCTGTCGAGCACGTGCCAGAGGCAACCTGGACTGGCTGTCCGACATACTGGCCACCTCACATATTC
CTGGAATGCAATGAGCAGTCTCTGCAGCTGCGGCGACGTCAACACTTCCAGAATGATCTTCCGATAGAGCTGACT
GGCCTGTTACGGTCTGGGGAAAACACAATTCGCGTCAGTCTGCCTCGGGTCGGGCCCAACATCGACAAGGTGTCG
ACGTACTTCATCGGTGTCGAGATGATTGAGACCTTGGACCACGAGACCGTACTTGCCATGGTCGAGGAGAACCCC
AGGACCAGCATCGAAGAGACCAAGCAGAAGGTATGCCAGAGACTGAAGCCGGATGGCTCGGACGACATCATTGCC
GAGGGCGACCACATTTGTGTGGCAGTGACGGATCCTTTCAGTTCCTCCCTCTTCGAGATTCCCGTTCGAGGAGCC
GACTGCAAGCATTGGGAGTGCTTCGATCTGGACATCTGGCTGCGGACGCGCCGCGGAAAGCGATCCGGCGACACT
GGAGAACCGACCGTGCCGGATTGTTGGAAATGCCCCGTCTGCGATCTGGACGCGAGGCCCGTCCGCCTTCGTATC
GACGAGTTCTTTACCGACGTTCGGGCCAAGCTCATCAAGAACGGGGAAGAGAGAATAAAAAAGATATCTATCCAG
TTTGATGGTTCCTGGCGTCCGCTGCCGGAACCGGACGAGGCCGAAGATGAGAAACAGCCGCCCGCCACGAGTGGC
CAATCCGGGCCCCCACAGGTTGCAGCCTCGGAGACCGCGCAAGTGATAATTATTGACGACGACTAG
Gene >Ophun1|4955
ATGCTCATTGCGGGTCGGGACCCTCAGCTTCTGGAAGCCTCTGAAAACAAGCTCGGTCACGTGCGTCGCAGAATT
TCTCACGCAAGGGCCCAGGAGGATCGACTTTGATGAAGGGGATGGTTGCCGCAAGCCACAAGTCGACGCTGACGA
CCGGGTAAAGACGCGCCATTGCTTTCATCCGAGTGGCAAACGCAGCACAATCTGAGAAGGGCTCGTACATTCATG
CAGGCATACAAATACATTCAAGTAGTATGCGTGTTGTATGTACGCGCCCGTTGGCGACCACCGCGTCTCGGCCAA
TTCTCTCACCTGACGCGCCGTTGCCTAGCCATCTGTGTTTGACGGCTTCTCCAGGCAGGTCAAAACAGTCCCCGG
TCGAGAGGCTCTGGCTGGCTTGCTTGCAGCTGTTGGCCACTCCATGGATAGTTGCTTGCTGACTACTGAAGTCTG
ACCGCCACTAGCTCATCCTCTACCAGCGGTCAACGGTCAAGACTGCCTCCCGCGTCGACGGCCAAGCGGCTTTAA
TCCTCCAGCCCCAGCTCGCAAGTCAGCCCCTGTCGTCGATAGCAGCAGACGCATGGCCCATCCCAGACTCGCCAT
ACATGCCAGCCTCGAAGCGTCGTCCTCGCTCAGAGGCCGTCCATGAGGCGGCTCGTCCGCCCCTCGACGCTAGCA
ATGAGACATCGCGAGCCTTTCTCGGCGTGCAACGCCGTGCGTGGATGACGACGACTGGTTCAGACTCGCCGATCG
TCGCCCGCGCAAAGCCTCACGCGCCGACGCGTCGCCCTGAACTGCCTGTCATACCGCCTGTCAATCCTTCTGCCG
TCGTCAGCCCCCCGCCGAGGTAAGACTTGTCATCCCGTCCCATTTCCAATGATTTACTGACGCTGCCCAGTGTTA
CTTCAATCCTCCCATCGCCCGTCAACTCGAGCATCTCGAGCCCCGAGGTCTCTACCTTGGGGCCGGCTCCGGCTG
GCAACCCCGAGACGGTCGATGCGCCGCCTCCGGGCCTCGCCATGGCTGGCTCTCCGCCGACGGCCCAGGTCCCGA
GCCCTCCGTCGTTTGACCCTCTTTCGTCCACCGAAGCCGACCCGTGTCTTGTCCCGGCTGCATCGCGCCACCTCG
CTCCTACGCAGCAAGACATGACAGCCGAGTTCACCGAGCTTGCTCTGGTGCCCGTATCGACCCAGTCAGACGCAA
CCCCCGCTGCCGAAACCTACCCGACGCCTCAACACCAGCCACCTCCTACCGCGTCACTTTCACACGGCACTTTCG
TCGCCGCGCCCCAGCAGAACTACGTTCGGCCGAGAGACGTACAACCAGACAGACAGCCGAAGCGACATTGCTCCG
AGGCTTCGCGACGGCCTTTGGTTACCCAGTCCGCCTTCGGGGGCTATGCCGTCGACTTTGATCAGTTGCTGGCCC
TCGTCGAGAATCATGTGCGACAATTGGGAAGCGCCCTCCGCGGTGATGTCATCGCCTATCGGCTGCTGGCGTCGG
CTTGCTCCAAGGGGGATTTCTTCTTCCTTGTCCTGCATCAAGCATACTGTCTGTGGTCGTTGAGCAGTCAGATGG
CATGTTGGCTGCTCGATGCCCAGCCGGACGTCGTCGATACGGCATTCCACCAACTGCAATGGTCATGGAGGCGAA
ACTCGGATTTATCGCCCTACCACCTTCGCTGGTTTGCCTCGTTTCCTCTCTTGACAACGAGAAACTCAAGTGCCA
TGCGCCTCCCCAAACTCATGGCCACCAACCTCATACCCGCCATCAATAATTTCCTCGTCTTGTTGGGGCAGAATT
GGAACCTCCTGCTGGAACAAGTCGTCCACAGGGGCTACCCGCTAATGGCATGGGAGATGAATAACCTTTTGCAAT
GCTCATCGTCTGTGCTGCGATCAATCCTCTTCATCTGCAGTCGTCGACCCTTTGGTGTTTTTGAGGGAAGTTCCT
TGACGAATGCCTTGTCCCAGCTGTTTGACCTGGATTTCTGCAATGAAGCTTCGGGACACGTCGACTCGCCCGATG
TGGTCAACATGCGGATGGTAATCAGGGATAGGTATATTGCCATGATGCAACAAGGCAGAGGTAACGTACCTTCAC
CCCCTCATGAGGAATTATTCTTACTGACTGGAAACTGGAAGCTTGTTCCTCCAACCACGCATCTGTAGCCAACCA
AGCCCAAGTGTTGGCACAGCATCAACTGGGCATACAAAATCCATCCTCAGCAACGCAGCAGATGTTACCGGCACT
CCCGATGGCCTCTCATGCTGTCCCCATGTCATCACCCGCATCTTCGACGCCTCGAAACGCAGGCAACCAATACTT
CCCAGTATTGGGGAGCAATGCCAACATGAGTGCTGCTCAAAGGCCGGCTCAGCCTCATCTGGTACCATTCGGTTT
CTCCGGCTCGCCGTCAGTCCCTGGCGGCGGGCAGACGGGCGGTGTCTTCACATCGCCTGCGATGCCCAACATGAC
TCCTTCTCAGCCTGCGCCATATTTCCCTCGAATTCAACAGCCACAGATGTTGCCAACGACGCAGCGTCCGATGCC
GGCGGTTCAGAACCGCGTCCCGCAAACGACGGCAACGGCGGGTCTTACTTCTGCCCGAGGCCCGGTCCCCCATCC
ACAGCCGCAGCACACCGGCTCTCAGGCTATGCAGCCTGCATTGACGTGGCCCAGCGCCGTCCAGCCTCGTCCGGG
TCCTCAACACGCCATTGTGCGGACACAGACTACACCGCGGTCACGAGGCGCAACGGCTAGCCAGCATCGAGTCGT
TCCGCTAGGGGATCATGAAATTCCTCGAGAAGAGTGGACGCGTGCCCAACATGGCCTGCACTTGTCGTCTCTGCG
CAGCCCCAAGTTGATTTGCGCGAGTCCCTCTGGCAGTCGCTTTTACCAGTTTATGACGCACTTCGCTGTAGCGCC
GCAAGCCCTGCCTCCTCAGCCTGGCCTGAGAGATTTCCGCTTTTCTCTATCGGAGGAACAAGTGTCCATGTTGGT
CAGAGCGGACACCAAGACTCATGCGACCAATGTTCCGTTTCACAATCGATCTCTTCGCTGTCGCCTTCGTCTGTG
CAAACAAGGACAAGCTGTCGAGCACGTGCCAGAGGCAACCTGGACTGGCTGTCCGACATACTGGCCACCTCACAT
ATTCCTGGAATGCAATGAGCAGTCTCTGCAGCTGCGGCGACGTCAACACTTCCAGAATGATCTTCCGATAGAGCT
GACTGGCCTGTTACGGTCTGGGGAAAACACAATTCGCGTCAGTCTGCCTCGGGTCGGGCCCAACATCGACAAGGT
GTCGACGTACTTCATCGGTGTCGAGATGATTGAGACCTTGGACCACGAGACCGTACTTGCCATGGTCGAGGAGAA
CCCCAGGACCAGCATCGAAGAGACCAAGCAGAAGGTATGCCAGAGACTGAAGCCGGATGGCTCGGACGACATCAT
TGCCGAGGGCGACCACATTTGTGTGGCAGTGACGGATCCTTTCAGTTCCTCCCTCTTCGAGATTCCCGTTCGAGG
AGCCGACTGCAAGCATTGGGAGTGCTTCGATCTGGACATCTGGCTGCGGACGCGCCGCGGAAAGCGATCCGGCGA
CACTGGAGAACCGACCGTGCCGGATTGTTGGAAATGCCCCGTCTGCGATCTGGACGCGAGGCCCGTCCGCCTTCG
TATCGACGAGTTCTTTACCGACGTTCGGGCCAAGCTCATCAAGAACGGGGAAGAGAGAATAAAAAAGATATCTAT
CCAGTTTGATGGTTCCTGGCGTCCGCTGCCGGAACCGGACGAGGCCGAAGATGAGAAACAGCCGCCCGCCACGAG
TGGCCAATCCGGGCCCCCACAGGTTGCAGCCTCGGAGACCGCGCAAGTGATAATTATTGACGACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail