Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4953
Gene name
LocationContig_470:4522..5642
Strand-
Gene length (bp)1120
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17144 Ribosomal_L5e Ribosomal large subunit proteins 60S L5, and 50S L18 3.3E-79 14 179
PF14204 Ribosomal_L18_c Ribosomal L18 C-terminal region 4.6E-13 239 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59953|RL5_NEUCR 60S ribosomal protein L5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-5 PE=3 SV=1 1 300 5.0E-174
sp|O74306|RL5B_SCHPO 60S ribosomal protein L5-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl502 PE=2 SV=1 1 294 2.0E-126
sp|P26321|RL5_YEAST 60S ribosomal protein L5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL5 PE=1 SV=4 1 286 1.0E-125
sp|P52822|RL5A_SCHPO 60S ribosomal protein L5-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl501 PE=1 SV=2 1 294 1.0E-125
sp|Q9W5R8|RL5_DROME 60S ribosomal protein L5 OS=Drosophila melanogaster GN=RpL5 PE=1 SV=2 1 271 2.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59953|RL5_NEUCR 60S ribosomal protein L5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-5 PE=3 SV=1 1 300 5.0E-174
sp|O74306|RL5B_SCHPO 60S ribosomal protein L5-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl502 PE=2 SV=1 1 294 2.0E-126
sp|P26321|RL5_YEAST 60S ribosomal protein L5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL5 PE=1 SV=4 1 286 1.0E-125
sp|P52822|RL5A_SCHPO 60S ribosomal protein L5-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl501 PE=1 SV=2 1 294 1.0E-125
sp|Q9W5R8|RL5_DROME 60S ribosomal protein L5 OS=Drosophila melanogaster GN=RpL5 PE=1 SV=2 1 271 2.0E-106
sp|Q4KTI3|RL5_SUBDO 60S ribosomal protein L5 OS=Suberites domuncula GN=RPL5 PE=2 SV=1 1 269 2.0E-105
sp|O65353|RL5_HELAN 60S ribosomal protein L5 OS=Helianthus annuus GN=RPL5A PE=2 SV=1 1 291 5.0E-105
sp|Q26481|RL5_STYCL 60S ribosomal protein L5 OS=Styela clava GN=RPL5 PE=3 SV=3 1 269 4.0E-104
sp|Q5XUC7|RL5_TOXCI 60S ribosomal protein L5 OS=Toxoptera citricida GN=RpL5 PE=2 SV=1 1 292 5.0E-104
sp|Q56FG6|RL5_LYSTE 60S ribosomal protein L5 OS=Lysiphlebus testaceipes GN=RpL5 PE=2 SV=1 1 292 5.0E-103
sp|Q4UDE7|RL5_THEAN 60S ribosomal protein L5 OS=Theileria annulata GN=RPL5 PE=3 SV=1 1 300 9.0E-103
sp|P22451|RL5_CHICK 60S ribosomal protein L5 OS=Gallus gallus GN=RPL5 PE=2 SV=2 1 254 2.0E-102
sp|P15125|RL5A_XENLA 60S ribosomal protein L5-A OS=Xenopus laevis GN=rpl5-a PE=2 SV=2 1 301 3.0E-102
sp|Q4N655|RL5_THEPA 60S ribosomal protein L5 OS=Theileria parva GN=RPL5 PE=3 SV=1 1 300 4.0E-102
sp|P15126|RL5B_XENLA 60S ribosomal protein L5-B OS=Xenopus laevis GN=rpl5-b PE=2 SV=2 1 301 5.0E-102
sp|Q6UNT2|RL5_CUCSA 60S ribosomal protein L5 OS=Cucumis sativus GN=RPL5 PE=2 SV=1 1 297 1.0E-101
sp|Q0JGY1|RL51_ORYSJ 60S ribosomal protein L5-1 OS=Oryza sativa subsp. japonica GN=RPL5A PE=2 SV=1 3 297 1.0E-100
sp|Q8LBI1|RL51_ARATH 60S ribosomal protein L5-1 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=2 1 297 5.0E-100
sp|A2WXX3|RL51_ORYSI 60S ribosomal protein L5-1 OS=Oryza sativa subsp. indica GN=RPL5A PE=3 SV=2 3 297 1.0E-99
sp|P49227|RL52_ARATH 60S ribosomal protein L5-2 OS=Arabidopsis thaliana GN=RPL5B PE=2 SV=3 1 297 3.0E-99
sp|O22608|RL5_DUNSA 60S ribosomal protein L5 OS=Dunaliella salina GN=RPL5 PE=2 SV=1 1 255 3.0E-98
sp|Q1HQU2|RL5_AEDAE 60S ribosomal protein L5 OS=Aedes aegypti GN=RpL5 PE=2 SV=1 1 254 3.0E-98
sp|Q627R7|RL5_CAEBR 60S ribosomal protein L5 OS=Caenorhabditis briggsae GN=rpl-5 PE=3 SV=2 1 266 2.0E-97
sp|P49405|RL5_CAEEL 60S ribosomal protein L5 OS=Caenorhabditis elegans GN=rpl-5 PE=3 SV=1 1 253 3.0E-95
sp|Q5EY89|RL5_EIMTE 60S ribosomal protein L5 OS=Eimeria tenella GN=RPL5 PE=2 SV=1 1 301 3.0E-95
sp|Q8L4L4|RL52_ORYSJ 60S ribosomal protein L5-2 OS=Oryza sativa subsp. japonica GN=RPL5B PE=3 SV=1 3 297 8.0E-95
sp|O76190|RL5_BOMMO 60S ribosomal protein L5 OS=Bombyx mori GN=RpL5 PE=2 SV=1 1 300 1.0E-94
sp|P46777|RL5_HUMAN 60S ribosomal protein L5 OS=Homo sapiens GN=RPL5 PE=1 SV=3 1 254 7.0E-94
sp|Q58DW5|RL5_BOVIN 60S ribosomal protein L5 OS=Bos taurus GN=RPL5 PE=2 SV=3 1 254 9.0E-94
sp|Q6JWW5|RL5_OIKDI 60S ribosomal protein L5 OS=Oikopleura dioica GN=RPL5 PE=3 SV=1 3 269 1.0E-93
sp|O44248|RL5_ANOGA 60S ribosomal protein L5 OS=Anopheles gambiae GN=RpL5 PE=2 SV=3 1 250 3.0E-93
sp|Q4R5M0|RL5_MACFA 60S ribosomal protein L5 OS=Macaca fascicularis GN=RPL5 PE=2 SV=3 1 254 3.0E-93
sp|Q54XX3|RL5_DICDI 60S ribosomal protein L5 OS=Dictyostelium discoideum GN=rpl5 PE=1 SV=1 1 284 3.0E-91
sp|P47962|RL5_MOUSE 60S ribosomal protein L5 OS=Mus musculus GN=Rpl5 PE=1 SV=3 1 254 1.0E-90
sp|P09895|RL5_RAT 60S ribosomal protein L5 OS=Rattus norvegicus GN=Rpl5 PE=1 SV=3 1 254 6.0E-90
sp|Q231U7|RL5_TETTS 60S ribosomal protein L5 OS=Tetrahymena thermophila (strain SB210) GN=RPL5 PE=1 SV=2 1 300 3.0E-82
sp|Q95276|RL5_PIG 60S ribosomal protein L5 (Fragment) OS=Sus scrofa GN=RPL5 PE=2 SV=3 1 121 6.0E-43
sp|A4WMD6|RL18_PYRAR 50S ribosomal protein L18 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl18 PE=3 SV=1 11 252 9.0E-32
sp|A7I5Q8|RL18_METB6 50S ribosomal protein L18 OS=Methanoregula boonei (strain 6A8) GN=rpl18 PE=3 SV=1 11 216 3.0E-31
sp|Q8ZVV7|RL18_PYRAE 50S ribosomal protein L18 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl18 PE=3 SV=1 11 252 4.0E-31
sp|A8M9I3|RL18_CALMQ 50S ribosomal protein L18 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl18 PE=3 SV=1 11 259 5.0E-31
sp|O26130|RL18_METTH 50S ribosomal protein L18 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl18 PE=3 SV=1 11 253 2.0E-30
sp|P54044|RL18_METJA 50S ribosomal protein L18 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl18 PE=3 SV=1 16 250 6.0E-30
sp|A6UWV7|RL18_META3 50S ribosomal protein L18 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl18 PE=3 SV=1 11 245 2.0E-29
sp|Q2FSH0|RL18_METHJ 50S ribosomal protein L18 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl18 PE=3 SV=1 15 210 8.0E-29
sp|B1Y8V2|RL18_PYRNV 50S ribosomal protein L18 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl18 PE=3 SV=1 14 252 1.0E-28
sp|A3CT16|RL18_METMJ 50S ribosomal protein L18 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl18 PE=3 SV=1 15 217 1.0E-28
sp|A1RVN4|RL18_PYRIL 50S ribosomal protein L18 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl18 PE=3 SV=1 14 252 4.0E-28
sp|A3MSJ3|RL18_PYRCJ 50S ribosomal protein L18 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl18 PE=3 SV=1 14 252 6.0E-28
sp|B8GKF2|RL18_METPE 50S ribosomal protein L18 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl18 PE=3 SV=1 11 185 7.0E-28
sp|Q9YF94|RL18_AERPE 50S ribosomal protein L18 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl18 PE=3 SV=1 25 252 2.0E-27
sp|A5UL69|RL18_METS3 50S ribosomal protein L18 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl18 PE=3 SV=1 11 252 3.0E-27
sp|A2SPM1|RL18_METLZ 50S ribosomal protein L18 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl18 PE=3 SV=1 11 215 9.0E-26
sp|A1RWR7|RL18_THEPD 50S ribosomal protein L18 OS=Thermofilum pendens (strain Hrk 5) GN=rpl18 PE=3 SV=1 11 252 1.0E-25
sp|P14033|RL18_METVA 50S ribosomal protein L18 OS=Methanococcus vannielii GN=rpl18 PE=3 SV=1 11 250 5.0E-25
sp|A6UQ63|RL18_METVS 50S ribosomal protein L18 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl18 PE=3 SV=1 11 250 6.0E-25
sp|Q0W1W9|RL18_METAR 50S ribosomal protein L18 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl18 PE=3 SV=1 15 201 6.0E-25
sp|O28373|RL18_ARCFU 50S ribosomal protein L18 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl18 PE=3 SV=1 11 228 8.0E-25
sp|P50562|RL18_HALSA 50S ribosomal protein L18 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl18 PE=1 SV=3 15 253 1.0E-24
sp|B0R675|RL18_HALS3 50S ribosomal protein L18 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl18 PE=3 SV=1 15 253 1.0E-24
sp|A6VH04|RL18_METM7 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl18 PE=3 SV=1 11 239 4.0E-24
sp|A9A9P5|RL18_METM6 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl18 PE=3 SV=1 11 239 4.0E-24
sp|A3DNC6|RL18_STAMF 50S ribosomal protein L18 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl18 PE=3 SV=1 14 253 6.0E-24
sp|Q975J9|RL18_SULTO 50S ribosomal protein L18 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl18 PE=3 SV=1 11 252 8.0E-24
sp|A4FWA2|RL18_METM5 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl18 PE=3 SV=1 11 245 1.0E-23
sp|B1L785|RL18_KORCO 50S ribosomal protein L18 OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl18 PE=3 SV=1 11 242 1.0E-23
sp|Q6LXD4|RL18_METMP 50S ribosomal protein L18 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl18 PE=3 SV=1 11 239 4.0E-23
sp|C6A179|RL18_THESM 50S ribosomal protein L18 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl18 PE=3 SV=1 25 252 7.0E-23
sp|P50563|RL18_HALVD 50S ribosomal protein L18 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rpl18 PE=1 SV=2 11 253 2.0E-22
sp|Q8TZA5|RL18_METKA 50S ribosomal protein L18 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl18 PE=3 SV=1 25 253 2.0E-22
sp|A2BMD8|RL18_HYPBU 50S ribosomal protein L18 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl18 PE=3 SV=1 11 253 3.0E-22
sp|Q12ZT2|RL18_METBU 50S ribosomal protein L18 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl18 PE=3 SV=1 15 212 4.0E-22
sp|P14123|RL18_HALMA 50S ribosomal protein L18 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl18 PE=1 SV=3 11 226 4.0E-22
sp|Q2NFX6|RL18_METST 50S ribosomal protein L18 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl18 PE=3 SV=1 16 252 5.0E-22
sp|B6YSN3|RL18_THEON 50S ribosomal protein L18 OS=Thermococcus onnurineus (strain NA1) GN=rpl18 PE=3 SV=1 25 252 8.0E-22
sp|Q9V1V4|RL18_PYRAB 50S ribosomal protein L18 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl18 PE=3 SV=1 25 252 8.0E-22
sp|A4YCY5|RL18_METS5 50S ribosomal protein L18 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl18 PE=3 SV=1 11 252 1.0E-21
sp|O59438|RL18_PYRHO 50S ribosomal protein L18 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl18 PE=3 SV=2 25 252 1.0E-21
sp|Q9HH80|RL18_PYRFU 50S ribosomal protein L18 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl18 PE=1 SV=1 25 264 2.0E-21
sp|A0B9V1|RL18_METTP 50S ribosomal protein L18 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl18 PE=3 SV=1 25 201 5.0E-21
sp|P50561|RL18_HALMT 50S ribosomal protein L18 OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=rpl18 PE=1 SV=2 11 253 9.0E-21
sp|Q3IMW9|RL18_NATPD 50S ribosomal protein L18 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl18 PE=3 SV=1 11 226 1.0E-20
sp|Q9UX88|RL18_SULSO 50S ribosomal protein L18 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl18 PE=3 SV=1 16 252 7.0E-20
sp|A8AC01|RL18_IGNH4 50S ribosomal protein L18 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl18 PE=3 SV=1 14 253 2.0E-19
sp|B8D5V1|RL18_DESK1 50S ribosomal protein L18 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl18 PE=3 SV=1 15 252 3.0E-19
sp|P93779|RL5_SOLME 60S ribosomal protein L5 (Fragment) OS=Solanum melongena GN=RPL5 PE=2 SV=1 189 299 4.0E-19
sp|C3NH90|RL18_SULIN 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl18 PE=3 SV=1 16 251 4.0E-19
sp|Q74MJ4|RL18_NANEQ 50S ribosomal protein L18 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl18 PE=3 SV=1 25 250 6.0E-19
sp|O05640|RL18_SULAC 50S ribosomal protein L18 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl18 PE=3 SV=1 16 253 1.0E-18
sp|Q8PV31|RL18_METMA 50S ribosomal protein L18 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl18 PE=3 SV=2 15 220 1.0E-18
sp|C3NEG2|RL18_SULIY 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl18 PE=3 SV=1 16 251 1.0E-18
sp|C3MVJ7|RL18_SULIM 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl18 PE=3 SV=1 16 251 1.0E-18
sp|C3MQ78|RL18_SULIL 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl18 PE=3 SV=1 16 251 1.0E-18
sp|C4KHH5|RL18_SULIK 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl18 PE=3 SV=1 16 251 1.0E-18
sp|C3N5U6|RL18_SULIA 50S ribosomal protein L18 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl18 PE=3 SV=1 16 251 1.0E-18
sp|Q8TRS8|RL18_METAC 50S ribosomal protein L18 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl18 PE=3 SV=1 11 220 2.0E-18
sp|Q46GB4|RL18_METBF 50S ribosomal protein L18 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl18 PE=3 SV=1 15 220 2.0E-18
sp|C5A266|RL18_THEGJ 50S ribosomal protein L18 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl18 PE=3 SV=1 52 252 4.0E-18
sp|Q5JJG7|RL18_THEKO 50S ribosomal protein L18 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl18 PE=3 SV=1 52 252 5.0E-18
sp|B9LSQ8|RL18_HALLT 50S ribosomal protein L18 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl18 PE=3 SV=1 15 253 1.0E-17
sp|Q18GG8|RL18_HALWD 50S ribosomal protein L18 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl18 PE=3 SV=1 15 181 3.0E-17
sp|P19949|RL5_RABIT 60S ribosomal protein L5 (Fragments) OS=Oryctolagus cuniculus GN=RPL5 PE=1 SV=2 3 49 3.0E-15
sp|Q97BV7|RL18_THEVO 50S ribosomal protein L18 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl18 PE=3 SV=1 20 184 1.0E-14
sp|Q9HIS6|RL18_THEAC 50S ribosomal protein L18 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl18 PE=3 SV=1 20 199 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0008097 5S rRNA binding Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0097159 organic cyclic compound binding No
GO:0019843 rRNA binding No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0003676 nucleic acid binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0003723 RNA binding No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0019538 protein metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2047
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5301
Ophiocordyceps australis map64 (Brazil) OphauB2|3843
Ophiocordyceps camponoti-floridani Ophcf2|00934
Ophiocordyceps camponoti-rufipedis Ophun1|4953 (this protein)
Ophiocordyceps kimflemingae Ophio5|5284
Ophiocordyceps subramaniannii Hirsu2|2357

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4953
MPFHKLVKNSAYHSRYQTKYKRRRQGKTDYYARKRLVTQAKNKYNSPKHRLVVRFTNKDIIMQIVTSEISGDKIL
VSAYSHELKAYGIKHGLTNWAAAYATGLLIARRVLGKLGLDKHFTGVEEPDGEFTLTEAAETDSGERRPFKAFLD
VGLARTTTGARVFGAMKGASDGGILIPHSEKRFPGYDVETKELDAETLRKYIFGGHVAEYMETLADDDEERYQGQ
FQKYIDDDVEAEGLEDLYTEAHSAIREDPWKKESGEGKKSKEEWKAISKKYRTLKTPKAEKDKKVQERIQKILAE
E*
Coding >Ophun1|4953
ATGCCTTTCCACAAGTTGGTTAAGAACAGCGCGTACCACAGCCGCTACCAGACCAAGTACAAGCGCAGACGTCAA
GGGAAGACGGACTACTATGCTCGCAAGCGCCTCGTCACCCAGGCCAAGAACAAGTACAATTCGCCGAAGCACAGG
CTCGTGGTCCGATTCACGAACAAGGACATCATCATGCAGATTGTCACGTCGGAAATCAGCGGTGACAAGATTCTC
GTCTCTGCTTACTCGCACGAGCTCAAGGCCTACGGCATCAAGCACGGCCTGACCAACTGGGCTGCAGCCTATGCC
ACCGGTCTGCTCATCGCGCGCCGTGTCCTTGGCAAGCTCGGCCTCGACAAGCACTTTACCGGCGTGGAGGAGCCC
GATGGCGAGTTCACTCTGACCGAAGCGGCCGAGACGGACAGCGGCGAGCGCCGTCCTTTCAAGGCCTTCCTCGAC
GTTGGTCTCGCTCGCACGACGACGGGCGCCCGTGTTTTCGGCGCCATGAAGGGCGCGTCCGATGGCGGTATCCTG
ATCCCCCATTCGGAGAAGCGATTCCCCGGCTACGACGTGGAGACCAAGGAGCTCGATGCGGAGACGCTGCGCAAG
TACATCTTTGGCGGCCACGTCGCCGAGTACATGGAGACGCTGGCCGATGACGACGAGGAGCGCTACCAGGGCCAA
TTCCAGAAGTACATTGACGACGACGTCGAGGCTGAGGGCCTGGAGGACCTCTACACCGAGGCCCACAGCGCCATC
CGTGAGGATCCGTGGAAGAAGGAGTCGGGCGAGGGAAAGAAGAGCAAGGAGGAGTGGAAGGCCATCTCCAAGAAG
TACCGGACTCTGAAGACGCCCAAGGCCGAGAAGGATAAGAAGGTGCAGGAGAGGATCCAGAAAATTCTGGCGGAA
GAGTAG
Transcript >Ophun1|4953
ATGCCTTTCCACAAGTTGGTTAAGAACAGCGCGTACCACAGCCGCTACCAGACCAAGTACAAGCGCAGACGTCAA
GGGAAGACGGACTACTATGCTCGCAAGCGCCTCGTCACCCAGGCCAAGAACAAGTACAATTCGCCGAAGCACAGG
CTCGTGGTCCGATTCACGAACAAGGACATCATCATGCAGATTGTCACGTCGGAAATCAGCGGTGACAAGATTCTC
GTCTCTGCTTACTCGCACGAGCTCAAGGCCTACGGCATCAAGCACGGCCTGACCAACTGGGCTGCAGCCTATGCC
ACCGGTCTGCTCATCGCGCGCCGTGTCCTTGGCAAGCTCGGCCTCGACAAGCACTTTACCGGCGTGGAGGAGCCC
GATGGCGAGTTCACTCTGACCGAAGCGGCCGAGACGGACAGCGGCGAGCGCCGTCCTTTCAAGGCCTTCCTCGAC
GTTGGTCTCGCTCGCACGACGACGGGCGCCCGTGTTTTCGGCGCCATGAAGGGCGCGTCCGATGGCGGTATCCTG
ATCCCCCATTCGGAGAAGCGATTCCCCGGCTACGACGTGGAGACCAAGGAGCTCGATGCGGAGACGCTGCGCAAG
TACATCTTTGGCGGCCACGTCGCCGAGTACATGGAGACGCTGGCCGATGACGACGAGGAGCGCTACCAGGGCCAA
TTCCAGAAGTACATTGACGACGACGTCGAGGCTGAGGGCCTGGAGGACCTCTACACCGAGGCCCACAGCGCCATC
CGTGAGGATCCGTGGAAGAAGGAGTCGGGCGAGGGAAAGAAGAGCAAGGAGGAGTGGAAGGCCATCTCCAAGAAG
TACCGGACTCTGAAGACGCCCAAGGCCGAGAAGGATAAGAAGGTGCAGGAGAGGATCCAGAAAATTCTGGCGGAA
GAGTAG
Gene >Ophun1|4953
ATGGTGAGTCGAAGAACAGCCGGACAGAAATCTCGATGGGATCAAGTTCCATTTGCTCGCGCGGGAGAGTCAACG
CAAGATGCTTCGGACCGAGGACGAGCAAGTCTGAAGCGCAAATTGCTGACTCGGGGACTTTGAACGACAGCCTTT
CCACAAGTTGGTTAAGAACAGCGCGTACCACAGGTGAGAACCTCTCGGGAATCTACGTGTTCAGCATTTCCCATC
TGGTCTTGTGGGGAGCTGACGACGTCGCAGCCGCTACCAGACCAAGTACAAGCGCAGACGTCAAGGGAAGACGGA
CTACTATGCTCGCAAGCGCCTCGTCACCCAGGCCAAGAACAAGTACAATTCGCCGAAGCACAGGCTCGTGGTCCG
ATTCACGAACAAGGACATCATCATGCAGATTGTCACGTCGGAAATCAGCGGTGACAAGATTCTCGTCTCTGCTTA
CTCGCACGAGCTCAAGGCCTACGGCATCAAGCACGGCCTGACCAACTGGGCTGCAGCCTATGCCACCGGTCTGCT
CATCGCGCGCCGTGTCCTTGGCAAGCTCGGCCTCGACAAGCACTTTACCGGCGTGGAGGAGCCCGATGGCGAGTT
CACTCTGACCGAAGCGGCCGAGACGGACAGCGGCGAGCGCCGTCCTTTCAAGGCCTTCCTCGACGTTGGTCTCGC
TCGCACGACGACGGGCGCCCGTGTTTTCGGCGCCATGAAGGGCGCGTCCGATGGCGGTATCCTGATCCCCCATTC
GGAGAAGCGATTCCCCGGCTACGACGTGGAGACCAAGGAGCTCGATGCGGAGACGCTGCGCAAGTACATCTTTGG
CGGCCACGTCGCCGAGTACATGGAGACGCTGGCCGATGACGACGAGGAGCGCTACCAGGGCCAATTCCAGAAGTA
CATTGACGACGACGTCGAGGCTGAGGGCCTGGAGGACCTCTACACCGAGGCCCACAGCGCCATCCGTGAGGATCC
GTGGAAGAAGGAGTCGGGCGAGGGAAAGAAGAGCAAGGAGGAGTGGAAGGCCATCTCCAAGAAGTACCGGACTCT
GAAGACGCCCAAGGCCGAGAAGGATAAGAAGGTGCAGGAGAGGATCCAGAAAATTCTGGCGGAAGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail