Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4948
Gene name
LocationContig_47:41631..43627
Strand+
Gene length (bp)1996
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain 1.3E-102 90 401
PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain 7.1E-28 405 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Y8|SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qrs1 PE=3 SV=1 73 627 0.0E+00
sp|P13188|SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN4 PE=1 SV=2 72 627 0.0E+00
sp|Q9Y105|SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster GN=Aats-gln PE=2 SV=1 86 628 5.0E-147
sp|P14325|SYQ_DICDI Probable glutamine--tRNA ligase OS=Dictyostelium discoideum GN=glnS PE=2 SV=2 90 627 3.0E-145
sp|Q8W4F3|SYQ_ARATH Glutamine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=OVA9 PE=2 SV=1 90 627 1.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Y8|SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qrs1 PE=3 SV=1 73 627 0.0E+00
sp|P13188|SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN4 PE=1 SV=2 72 627 0.0E+00
sp|Q9Y105|SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster GN=Aats-gln PE=2 SV=1 86 628 5.0E-147
sp|P14325|SYQ_DICDI Probable glutamine--tRNA ligase OS=Dictyostelium discoideum GN=glnS PE=2 SV=2 90 627 3.0E-145
sp|Q8W4F3|SYQ_ARATH Glutamine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=OVA9 PE=2 SV=1 90 627 1.0E-143
sp|Q3MHH4|SYQ_BOVIN Glutamine--tRNA ligase OS=Bos taurus GN=QARS PE=2 SV=1 11 627 7.0E-143
sp|P47897|SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens GN=QARS PE=1 SV=1 11 627 2.0E-142
sp|O62431|SYQ_CAEEL Probable glutamine--tRNA ligase OS=Caenorhabditis elegans GN=ers-1 PE=3 SV=1 90 623 3.0E-142
sp|P52780|SYQ_LUPLU Glutamine--tRNA ligase OS=Lupinus luteus PE=2 SV=2 90 627 1.0E-138
sp|Q7UX42|SYQ_RHOBA Glutamine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glnS PE=3 SV=1 44 627 6.0E-129
sp|C4V819|SYQ_NOSCE Probable glutamine--tRNA ligase OS=Nosema ceranae (strain BRL01) GN=NCER_100619 PE=3 SV=1 57 621 2.0E-128
sp|B5FC12|SYQ_VIBFM Glutamine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=glnS PE=3 SV=1 65 623 6.0E-122
sp|Q5E6P2|SYQ_VIBF1 Glutamine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glnS PE=3 SV=1 65 623 6.0E-122
sp|B6EHL7|SYQ_ALISL Glutamine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=glnS PE=3 SV=1 65 623 5.0E-121
sp|Q88IU5|SYQ_PSEPK Glutamine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=glnS PE=3 SV=1 91 626 9.0E-121
sp|Q87RG4|SYQ_VIBPA Glutamine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glnS PE=3 SV=1 91 627 2.0E-120
sp|C3LTP5|SYQ_VIBCM Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=glnS PE=3 SV=1 91 627 8.0E-119
sp|Q9KTA6|SYQ_VIBCH Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glnS PE=3 SV=1 91 627 8.0E-119
sp|Q8SR10|SYQ_ENCCU Probable glutamine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_1460 PE=3 SV=1 62 625 2.0E-118
sp|A1SS83|SYQ_PSYIN Glutamine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=glnS PE=3 SV=1 74 626 2.0E-118
sp|A5F2T1|SYQ_VIBC3 Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=glnS PE=3 SV=1 91 623 4.0E-118
sp|B5XZG7|SYQ_KLEP3 Glutamine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=glnS PE=3 SV=1 91 627 6.0E-118
sp|C4L887|SYQ_TOLAT Glutamine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glnS PE=3 SV=1 74 623 8.0E-118
sp|Q0K808|SYQ_CUPNH Glutamine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glnS PE=3 SV=1 87 627 2.0E-117
sp|A4W846|SYQ_ENT38 Glutamine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=glnS PE=3 SV=1 74 627 2.0E-117
sp|A8GB43|SYQ_SERP5 Glutamine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=glnS PE=3 SV=1 74 627 3.0E-117
sp|A7MT45|SYQ_VIBCB Glutamine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=glnS PE=3 SV=1 91 627 3.0E-117
sp|Q81ZS7|SYQ_NITEU Glutamine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glnS1 PE=3 SV=1 66 622 3.0E-117
sp|Q2NUP0|SYQ_SODGM Glutamine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=glnS PE=3 SV=1 74 628 5.0E-117
sp|Q15TT6|SYQ_PSEA6 Glutamine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glnS PE=3 SV=1 65 627 6.0E-117
sp|B3R5N3|SYQ_CUPTR Glutamine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=glnS PE=3 SV=1 87 627 7.0E-117
sp|Q7MMQ4|SYQ_VIBVY Glutamine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=glnS PE=3 SV=1 91 627 7.0E-117
sp|A8AJD6|SYQ_CITK8 Glutamine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glnS PE=3 SV=1 74 627 1.0E-116
sp|B2VBN3|SYQ_ERWT9 Glutamine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glnS PE=3 SV=1 74 627 1.0E-116
sp|Q0TTG1|SYQ_CLOP1 Glutamine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glnS PE=3 SV=1 74 622 2.0E-116
sp|Q57RP8|SYQ_SALCH Glutamine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|A6T6C3|SYQ_KLEP7 Glutamine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glnS PE=3 SV=1 91 627 2.0E-116
sp|A7MQT2|SYQ_CROS8 Glutamine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|Q8ZQX5|SYQ_SALTY Glutamine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnS PE=3 SV=3 74 627 2.0E-116
sp|B5BCC3|SYQ_SALPK Glutamine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|C0PWA7|SYQ_SALPC Glutamine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|Q5PCH8|SYQ_SALPA Glutamine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|B4TB84|SYQ_SALHS Glutamine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|B5R651|SYQ_SALG2 Glutamine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|B5QWD0|SYQ_SALEP Glutamine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|B5FNC1|SYQ_SALDC Glutamine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|B5EZC3|SYQ_SALA4 Glutamine--tRNA ligase OS=Salmonella agona (strain SL483) GN=glnS PE=3 SV=1 74 627 2.0E-116
sp|B4SYN9|SYQ_SALNS Glutamine--tRNA ligase OS=Salmonella newport (strain SL254) GN=glnS PE=3 SV=1 74 627 3.0E-116
sp|Q8XMP3|SYQ_CLOPE Glutamine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=glnS PE=3 SV=1 74 622 3.0E-116
sp|B4TQ00|SYQ_SALSV Glutamine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=glnS PE=3 SV=1 74 627 4.0E-116
sp|Q8Z8F8|SYQ_SALTI Glutamine--tRNA ligase OS=Salmonella typhi GN=glnS PE=3 SV=3 74 627 4.0E-116
sp|B4EV71|SYQ_PROMH Glutamine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=glnS PE=3 SV=1 74 627 5.0E-116
sp|Q324M4|SYQ_SHIBS Glutamine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=glnS PE=3 SV=1 74 627 7.0E-116
sp|B2TU51|SYQ_SHIB3 Glutamine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glnS PE=3 SV=1 74 627 7.0E-116
sp|B5YQM4|SYQ_ECO5E Glutamine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glnS PE=3 SV=1 74 627 7.0E-116
sp|Q8X9H8|SYQ_ECO57 Glutamine--tRNA ligase OS=Escherichia coli O157:H7 GN=glnS PE=3 SV=3 74 627 7.0E-116
sp|C5BGA4|SYQ_EDWI9 Glutamine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=glnS PE=3 SV=1 74 627 9.0E-116
sp|A4VL72|SYQ_PSEU5 Glutamine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=glnS PE=3 SV=1 90 627 9.0E-116
sp|B7LKT3|SYQ_ESCF3 Glutamine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B1LLC4|SYQ_ECOSM Glutamine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7N9S6|SYQ_ECOLU Glutamine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|Q1REN7|SYQ_ECOUT Glutamine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|Q8FJW4|SYQ_ECOL6 Glutamine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glnS PE=3 SV=3 74 627 1.0E-115
sp|Q0TK03|SYQ_ECOL5 Glutamine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|A1A8U7|SYQ_ECOK1 Glutamine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7MPI5|SYQ_ECO81 Glutamine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7MFU7|SYQ_ECO45 Glutamine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7UKW1|SYQ_ECO27 Glutamine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|Q3Z4C0|SYQ_SHISS Glutamine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B6HYN9|SYQ_ECOSE Glutamine--tRNA ligase OS=Escherichia coli (strain SE11) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|P00962|SYQ_ECOLI Glutamine--tRNA ligase OS=Escherichia coli (strain K12) GN=glnS PE=1 SV=3 74 627 1.0E-115
sp|B1IY48|SYQ_ECOLC Glutamine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|A7ZXU0|SYQ_ECOHS Glutamine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B1X6L3|SYQ_ECODH Glutamine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|C4ZWF6|SYQ_ECOBW Glutamine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7M5J8|SYQ_ECO8A Glutamine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7L9L7|SYQ_ECO55 Glutamine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|A7ZJ63|SYQ_ECO24 Glutamine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|B7NMN1|SYQ_ECO7I Glutamine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glnS PE=3 SV=1 74 627 1.0E-115
sp|Q9I2U8|SYQ_PSEAE Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glnS PE=1 SV=1 90 627 2.0E-115
sp|Q83LY4|SYQ_SHIFL Glutamine--tRNA ligase OS=Shigella flexneri GN=glnS PE=3 SV=1 91 627 2.0E-115
sp|Q0T6S8|SYQ_SHIF8 Glutamine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=glnS PE=3 SV=1 91 627 2.0E-115
sp|Q0SVB1|SYQ_CLOPS Glutamine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=glnS PE=3 SV=1 74 622 2.0E-115
sp|Q02KT5|SYQ_PSEAB Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=glnS PE=3 SV=1 90 627 2.0E-115
sp|B7VB85|SYQ_PSEA8 Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=glnS PE=3 SV=1 90 627 2.0E-115
sp|Q32IQ0|SYQ_SHIDS Glutamine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glnS PE=3 SV=1 74 627 4.0E-115
sp|B2U846|SYQ_RALPJ Glutamine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=glnS PE=3 SV=1 86 627 4.0E-115
sp|A9MUG5|SYQ_SALPB Glutamine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glnS PE=3 SV=1 74 627 8.0E-115
sp|B4RYH7|SYQ_ALTMD Glutamine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glnS PE=3 SV=1 65 627 8.0E-115
sp|Q89KR6|SYQ_BRADU Glutamine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnS PE=3 SV=1 90 629 9.0E-115
sp|Q7VLM3|SYQ_HAEDU Glutamine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glnS PE=3 SV=1 74 623 1.0E-114
sp|Q1LQ72|SYQ_CUPMC Glutamine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=glnS PE=3 SV=1 62 627 1.0E-114
sp|Q4QK64|SYQ_HAEI8 Glutamine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=glnS PE=3 SV=1 91 623 2.0E-114
sp|C6DBY6|SYQ_PECCP Glutamine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glnS PE=3 SV=1 74 623 2.0E-114
sp|Q3IGW8|SYQ_PSEHT Glutamine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=glnS PE=3 SV=1 93 627 2.0E-114
sp|A1JQH0|SYQ_YERE8 Glutamine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glnS PE=3 SV=1 74 623 2.0E-114
sp|Q6LTD1|SYQ_PHOPR Glutamine--tRNA ligase OS=Photobacterium profundum GN=glnS PE=3 SV=1 91 627 2.0E-114
sp|Q7W4T0|SYQ_BORPA Glutamine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glnS PE=3 SV=1 90 623 5.0E-114
sp|Q66DC5|SYQ_YERPS Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|A4TNX8|SYQ_YERPP Glutamine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|Q1CKN4|SYQ_YERPN Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|A9R7G5|SYQ_YERPG Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|Q8ZDD9|SYQ_YERPE Glutamine--tRNA ligase OS=Yersinia pestis GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|B2K8A4|SYQ_YERPB Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|Q1C540|SYQ_YERPA Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|A7FKU1|SYQ_YERP3 Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glnS PE=3 SV=1 74 623 6.0E-114
sp|Q7VU94|SYQ_BORPE Glutamine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glnS PE=3 SV=1 90 623 6.0E-114
sp|P43831|SYQ_HAEIN Glutamine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glnS PE=3 SV=1 91 623 6.0E-114
sp|B1JG85|SYQ_YERPY Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glnS PE=3 SV=1 74 623 7.0E-114
sp|Q7WGA6|SYQ_BORBR Glutamine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glnS PE=3 SV=1 90 623 8.0E-114
sp|Q8Y199|SYQ_RALSO Glutamine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=glnS PE=3 SV=1 91 627 1.0E-113
sp|Q8K9E1|SYQ_BUCAP Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glnS PE=3 SV=2 71 623 2.0E-113
sp|Q7N743|SYQ_PHOLL Glutamine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glnS PE=3 SV=1 91 627 2.0E-113
sp|C1DHE5|SYQ_AZOVD Glutamine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glnS PE=3 SV=1 90 627 3.0E-113
sp|B7VIH6|SYQ_VIBTL Glutamine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=glnS PE=3 SV=1 74 627 4.0E-113
sp|Q6D7J7|SYQ_PECAS Glutamine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glnS PE=3 SV=1 74 623 5.0E-113
sp|A9MKA7|SYQ_SALAR Glutamine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glnS PE=3 SV=1 74 627 5.0E-113
sp|A4XVG2|SYQ_PSEMY Glutamine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=glnS PE=3 SV=1 90 627 6.0E-113
sp|C4K4J9|SYQ_HAMD5 Glutamine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=glnS PE=3 SV=1 91 626 2.0E-112
sp|Q47Z40|SYQ_COLP3 Glutamine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glnS PE=3 SV=1 91 627 1.0E-111
sp|A6VP11|SYQ_ACTSZ Glutamine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glnS PE=3 SV=1 61 623 3.0E-111
sp|Q8PCB3|SYQ_XANCP Glutamine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glnS PE=3 SV=1 52 627 3.0E-111
sp|Q4UR70|SYQ_XANC8 Glutamine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glnS PE=3 SV=1 52 627 3.0E-111
sp|A9CSU5|SYQ_ENTBH Probable glutamine--tRNA ligase OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22570 PE=3 SV=1 61 624 6.0E-111
sp|Q87YQ1|SYQ_PSESM Glutamine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glnS PE=3 SV=1 90 623 3.0E-110
sp|Q188C8|SYQ_PEPD6 Glutamine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=glnS PE=3 SV=1 89 622 5.0E-110
sp|Q5F7G0|SYQ_NEIG1 Glutamine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=glnS PE=3 SV=2 71 623 5.0E-110
sp|P57000|SYQ_NEIMA Glutamine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=glnS PE=3 SV=1 71 623 6.0E-110
sp|P57847|SYQ_PASMU Glutamine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=glnS PE=3 SV=1 64 623 8.0E-110
sp|Q8PNZ5|SYQ_XANAC Glutamine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glnS PE=3 SV=1 53 627 1.0E-109
sp|Q3BX52|SYQ_XANC5 Glutamine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glnS PE=3 SV=1 53 627 2.0E-109
sp|A4SZM1|SYQ_POLSQ Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=glnS PE=3 SV=1 91 623 2.0E-109
sp|Q3SRI8|SYQ_NITWN Glutamine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glnS PE=3 SV=1 90 627 3.0E-109
sp|Q1QMM1|SYQ_NITHX Glutamine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glnS PE=3 SV=1 90 627 5.0E-109
sp|Q5GWF4|SYQ_XANOR Glutamine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glnS PE=3 SV=1 91 627 6.0E-109
sp|Q2NZL7|SYQ_XANOM Glutamine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glnS PE=3 SV=1 91 627 6.0E-109
sp|Q5QXQ2|SYQ_IDILO Glutamine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glnS PE=3 SV=1 91 627 7.0E-109
sp|Q2KVX0|SYQ_BORA1 Glutamine--tRNA ligase OS=Bordetella avium (strain 197N) GN=glnS PE=3 SV=1 90 623 8.0E-109
sp|P57490|SYQ_BUCAI Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glnS PE=3 SV=1 93 623 2.0E-108
sp|B8D7U5|SYQ_BUCAT Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=glnS PE=3 SV=1 93 623 2.0E-108
sp|B8D9J3|SYQ_BUCA5 Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glnS PE=3 SV=1 93 623 4.0E-108
sp|A5N6Y3|SYQ_CLOK5 Glutamine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glnS PE=3 SV=1 89 622 2.0E-107
sp|B1XW11|SYQ_POLNS Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=glnS PE=3 SV=1 91 623 3.0E-107
sp|Q9PDP1|SYQ_XYLFA Glutamine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=glnS PE=3 SV=1 91 623 8.0E-107
sp|B0U6D0|SYQ_XYLFM Glutamine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=glnS PE=3 SV=1 91 623 2.0E-106
sp|Q8EG26|SYQ_SHEON Glutamine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=glnS PE=3 SV=1 74 623 2.0E-106
sp|Q87DU6|SYQ_XYLFT Glutamine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glnS PE=3 SV=1 91 623 4.0E-106
sp|P56927|SYQ_NEIMB Glutamine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=glnS PE=3 SV=1 71 623 5.0E-106
sp|Q7NX86|SYQ_CHRVO Glutamine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glnS PE=3 SV=1 74 623 4.0E-104
sp|Q89AD4|SYQ_BUCBP Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=glnS PE=3 SV=1 74 623 7.0E-99
sp|P56926|SYQ_DEIRA Glutamine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glnS PE=1 SV=1 90 628 1.0E-92
sp|A9A423|SYE_NITMS Glutamate--tRNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=gltX PE=3 SV=1 56 540 1.0E-70
sp|O59314|SYE_PYRHO Glutamate--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gltX PE=3 SV=1 90 487 3.0E-69
sp|Q5JH16|SYE_THEKO Glutamate--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gltX PE=3 SV=1 90 477 8.0E-69
sp|Q9V1E3|SYE_PYRAB Glutamate--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gltX PE=3 SV=1 90 483 1.0E-67
sp|Q8SSE4|SYEC_ENCCU Probable glutamate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_1210 PE=3 SV=1 87 540 4.0E-66
sp|Q8U064|SYE_PYRFU Glutamate--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gltX PE=3 SV=2 90 483 4.0E-66
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 90 517 1.0E-64
sp|B6YSY7|SYE_THEON Glutamate--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=gltX PE=3 SV=1 90 477 4.0E-64
sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 90 457 2.0E-63
sp|P46655|SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUS1 PE=1 SV=3 90 454 7.0E-63
sp|A0RY20|SYE_CENSY Glutamate--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=gltX PE=3 SV=1 90 528 6.0E-59
sp|Q54KB8|SYEC_DICDI Probable glutamate--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=gluS PE=2 SV=1 90 543 6.0E-59
sp|Q0W8L2|SYE_METAR Glutamate--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=gltX PE=3 SV=1 86 531 3.0E-57
sp|O13775|SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gus1 PE=1 SV=1 90 454 8.0E-57
sp|O82462|SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g26707 PE=1 SV=1 90 516 1.0E-56
sp|P28668|SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster GN=Aats-glupro PE=1 SV=2 58 454 6.0E-56
sp|Q58772|SYE_METJA Glutamate--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gltX PE=3 SV=1 89 457 2.0E-55
sp|Q74MU5|SYE_NANEQ Glutamate--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=gltX PE=3 SV=1 88 479 3.0E-54
sp|O29979|SYE_ARCFU Glutamate--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gltX PE=3 SV=1 90 455 4.0E-54
sp|A5UN79|SYE_METS3 Glutamate--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=gltX PE=3 SV=1 89 457 6.0E-54
sp|Q46CG5|SYE_METBF Glutamate--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gltX PE=3 SV=1 90 466 7.0E-54
sp|B1L5U2|SYE_KORCO Glutamate--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=gltX PE=3 SV=1 90 420 4.0E-53
sp|Q8TT52|SYE_METAC Glutamate--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gltX PE=3 SV=2 90 466 5.0E-52
sp|A2SRG2|SYE_METLZ Glutamate--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=gltX PE=3 SV=1 91 466 5.0E-52
sp|Q971D0|SYE_SULTO Glutamate--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gltX PE=3 SV=1 90 538 7.0E-52
sp|Q2FTH6|SYE_METHJ Glutamate--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gltX PE=3 SV=1 91 466 9.0E-52
sp|Q8ZU33|SYE_PYRAE Glutamate--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=gltX PE=3 SV=1 91 516 1.0E-51
sp|A3MV95|SYE_PYRCJ Glutamate--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=gltX PE=3 SV=1 91 457 2.0E-50
sp|A7IAG1|SYE_METB6 Glutamate--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=gltX PE=3 SV=1 21 458 3.0E-50
sp|A0B966|SYE_METTP Glutamate--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=gltX PE=3 SV=1 91 521 6.0E-50
sp|A4WKI4|SYE_PYRAR Glutamate--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=gltX PE=3 SV=1 89 516 1.0E-49
sp|A3CWJ3|SYE_METMJ Glutamate--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=gltX PE=3 SV=1 85 466 2.0E-49
sp|Q50543|SYE_METTM Glutamate--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=gltX PE=3 SV=1 21 457 3.0E-49
sp|C4VBI7|SYEC_NOSCE Probable glutamate--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_102160 PE=3 SV=1 81 454 5.0E-49
sp|O26157|SYE_METTH Glutamate--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gltX PE=1 SV=1 90 457 1.0E-48
sp|P95968|SYE_SULSO Glutamate--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gltX PE=3 SV=1 90 446 4.0E-48
sp|A8ABI5|SYE_IGNH4 Glutamate--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=gltX PE=3 SV=1 90 466 5.0E-48
sp|A1RRG7|SYE_PYRIL Glutamate--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=gltX PE=3 SV=1 91 516 6.0E-48
sp|A1RYD7|SYE_THEPD Glutamate--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=gltX PE=3 SV=1 85 450 2.0E-47
sp|Q4J8P2|SYE_SULAC Glutamate--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gltX PE=3 SV=1 88 435 2.0E-47
sp|A6UW15|SYE_META3 Glutamate--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=gltX PE=3 SV=1 91 450 3.0E-47
sp|A9CSZ1|SYEC_ENTBH Probable glutamate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22577 PE=3 SV=1 91 466 2.0E-46
sp|B1YAX4|SYE_PYRNV Glutamate--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=gltX PE=3 SV=1 91 537 4.0E-46
sp|A6VFU7|SYE_METM7 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gltX PE=3 SV=1 91 450 4.0E-46
sp|A2BK91|SYE_HYPBU Glutamate--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=gltX PE=3 SV=1 90 621 1.0E-45
sp|Q2NFU2|SYE_METST Glutamate--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gltX PE=3 SV=1 90 477 1.0E-45
sp|Q6LYI0|SYE_METMP Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=gltX PE=3 SV=1 91 450 5.0E-45
sp|A4FXG8|SYE_METM5 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gltX PE=3 SV=1 91 450 8.0E-45
sp|A6UP25|SYE_METVS Glutamate--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gltX PE=3 SV=1 89 450 1.0E-44
sp|A9AAT7|SYE_METM6 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gltX PE=3 SV=1 91 450 2.0E-44
sp|Q18GA5|SYE_HALWD Glutamate--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gltX PE=3 SV=1 82 454 5.0E-44
sp|Q8PW52|SYE_METMA Glutamate--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gltX PE=3 SV=1 88 466 5.0E-44
sp|Q12TN7|SYE_METBU Glutamate--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gltX PE=3 SV=1 86 501 2.0E-43
sp|A3DMR5|SYE_STAMF Glutamate--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=gltX PE=3 SV=1 90 528 4.0E-43
sp|Q979Q0|SYE_THEVO Glutamate--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gltX PE=3 SV=1 91 466 8.0E-43
sp|Q5V5N9|SYE_HALMA Glutamate--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gltX PE=3 SV=1 89 412 7.0E-42
sp|Q8TXB7|SYE_METKA Glutamate--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gltX PE=3 SV=1 90 476 2.0E-41
sp|A4YIL8|SYE_METS5 Glutamate--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gltX PE=3 SV=1 91 457 4.0E-41
sp|Q9Y9H1|SYE_AERPE Glutamate--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gltX PE=3 SV=2 90 454 1.0E-40
sp|Q9HQI1|SYE_HALSA Glutamate--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gltX PE=3 SV=1 89 412 4.0E-40
sp|B0R4Z6|SYE_HALS3 Glutamate--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gltX PE=3 SV=1 89 412 4.0E-40
sp|Q9HJM5|SYE_THEAC Glutamate--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gltX PE=3 SV=2 91 466 1.0E-38
sp|A8M9D7|SYE_CALMQ Glutamate--tRNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=gltX PE=3 SV=1 90 456 2.0E-38
sp|Q3IPL2|SYE_NATPD Glutamate--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gltX PE=3 SV=1 89 454 2.0E-38
sp|Q6L0N9|SYE_PICTO Glutamate--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=gltX PE=3 SV=1 91 466 3.0E-30
sp|B5EEE6|SYE_GEOBB Glutamate--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gltX PE=3 SV=1 90 417 5.0E-20
sp|B5YIG1|SYE_THEYD Glutamate--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gltX PE=3 SV=1 91 294 2.0E-19
sp|Q8RB93|SYE1_CALS4 Glutamate--tRNA ligase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX1 PE=3 SV=1 90 440 8.0E-19
sp|Q57LU0|SYE_SALCH Glutamate--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=gltX PE=3 SV=1 90 382 9.0E-19
sp|B3E399|SYE_GEOLS Glutamate--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gltX PE=3 SV=1 93 294 1.0E-18
sp|A0L669|SYE_MAGMM Glutamate--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gltX PE=3 SV=1 93 294 2.0E-18
sp|P0A2K3|SYE_SALTY Glutamate--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|P0A2K4|SYE_SALTI Glutamate--tRNA ligase OS=Salmonella typhi GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|B4TQE9|SYE_SALSV Glutamate--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|A9N372|SYE_SALPB Glutamate--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|B4SZT6|SYE_SALNS Glutamate--tRNA ligase OS=Salmonella newport (strain SL254) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|B4TCE7|SYE_SALHS Glutamate--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|B5F0E6|SYE_SALA4 Glutamate--tRNA ligase OS=Salmonella agona (strain SL483) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|B5BB76|SYE_SALPK Glutamate--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|Q5PNE5|SYE_SALPA Glutamate--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gltX PE=3 SV=1 90 382 2.0E-18
sp|B5R3U6|SYE_SALEP Glutamate--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=gltX PE=3 SV=1 90 382 3.0E-18
sp|B5RCP1|SYE_SALG2 Glutamate--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gltX PE=3 SV=2 90 382 3.0E-18
sp|Q04GX5|SYE_OENOB Glutamate--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=gltX PE=3 SV=1 88 379 4.0E-18
sp|A8ZWA3|SYE_DESOH Glutamate--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gltX PE=3 SV=1 90 290 4.0E-18
sp|Q30Y02|SYE_DESAG Glutamate--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=gltX PE=3 SV=1 90 294 5.0E-18
sp|B2IKL1|SYE1_BEII9 Glutamate--tRNA ligase 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX1 PE=3 SV=1 89 229 5.0E-18
sp|B5FQB0|SYE_SALDC Glutamate--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=gltX PE=3 SV=1 90 382 6.0E-18
sp|A9MIG3|SYE_SALAR Glutamate--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gltX PE=3 SV=1 90 379 6.0E-18
sp|B0K403|SYE2_THEPX Glutamate--tRNA ligase 2 OS=Thermoanaerobacter sp. (strain X514) GN=gltX2 PE=3 SV=1 90 300 1.0E-17
sp|Q3A413|SYE_PELCD Glutamate--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gltX PE=3 SV=1 90 294 1.0E-17
sp|B0KAA6|SYE2_THEP3 Glutamate--tRNA ligase 2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX2 PE=3 SV=1 90 300 1.0E-17
sp|Q2Y8L6|SYE_NITMU Glutamate--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gltX PE=3 SV=1 91 294 1.0E-17
sp|Q3JEF2|SYE1_NITOC Glutamate--tRNA ligase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gltX1 PE=3 SV=1 91 294 1.0E-17
sp|Q609J9|SYE2_METCA Glutamate--tRNA ligase 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gltX2 PE=3 SV=1 93 379 1.0E-17
sp|A1VBA3|SYE_DESVV Glutamate--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gltX PE=3 SV=1 90 294 3.0E-17
sp|Q728Q1|SYE_DESVH Glutamate--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gltX PE=3 SV=1 90 294 4.0E-17
sp|A9GZS1|SYE1_GLUDA Glutamate--tRNA ligase 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=gltX1 PE=3 SV=1 91 206 4.0E-17
sp|Q2G6Q3|SYE2_NOVAD Glutamate--tRNA ligase 2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gltX2 PE=3 SV=1 87 196 5.0E-17
sp|A6X0K5|SYE1_OCHA4 Glutamate--tRNA ligase 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX1 PE=3 SV=1 88 206 6.0E-17
sp|Q74DU6|SYE_GEOSL Glutamate--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gltX PE=3 SV=1 91 291 6.0E-17
sp|Q2LQN4|SYE1_SYNAS Glutamate--tRNA ligase 1 OS=Syntrophus aciditrophicus (strain SB) GN=gltX1 PE=3 SV=1 90 294 7.0E-17
sp|O67271|SYE_AQUAE Glutamate--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=gltX PE=3 SV=1 90 294 7.0E-17
sp|A8ADJ2|SYE_CITK8 Glutamate--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gltX PE=3 SV=1 90 382 8.0E-17
sp|B4U896|SYE_HYDS0 Glutamate--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=gltX PE=3 SV=1 91 219 8.0E-17
sp|B0K5F4|SYE1_THEPX Glutamate--tRNA ligase 1 OS=Thermoanaerobacter sp. (strain X514) GN=gltX1 PE=3 SV=1 93 294 8.0E-17
sp|A1AUQ6|SYE_PELPD Glutamate--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=gltX PE=3 SV=1 91 291 9.0E-17
sp|A0LI05|SYE_SYNFM Glutamate--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gltX PE=3 SV=1 91 294 1.0E-16
sp|Q0A936|SYE1_ALKEH Glutamate--tRNA ligase 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gltX1 PE=3 SV=1 90 292 1.0E-16
sp|Q38YY5|SYE_LACSS Glutamate--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gltX PE=3 SV=1 89 379 1.0E-16
sp|P31970|SYE_SYNP2 Glutamate--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gltX PE=3 SV=4 91 399 1.0E-16
sp|B3CLF5|SYE2_WOLPP Glutamate--tRNA ligase 2 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gltX2 PE=3 SV=1 91 216 2.0E-16
sp|Q98MD0|SYE1_RHILO Glutamate--tRNA ligase 1 OS=Rhizobium loti (strain MAFF303099) GN=gltX1 PE=3 SV=1 88 209 2.0E-16
sp|B5Y7R0|SYE_COPPD Glutamate--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gltX PE=3 SV=1 88 456 2.0E-16
sp|A5FZX8|SYE1_ACICJ Glutamate--tRNA ligase 1 OS=Acidiphilium cryptum (strain JF-5) GN=gltX1 PE=3 SV=1 91 294 2.0E-16
sp|B1I9D7|SYE_STRPI Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gltX PE=3 SV=1 88 379 3.0E-16
sp|Q3SI46|SYE_THIDA Glutamate--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gltX PE=3 SV=1 86 336 3.0E-16
sp|Q31Y73|SYE_SHIBS Glutamate--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=gltX PE=3 SV=1 90 379 3.0E-16
sp|Q5L431|SYE_GEOKA Glutamate--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=gltX PE=3 SV=1 88 379 3.0E-16
sp|Q0AIP6|SYE_NITEC Glutamate--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=gltX PE=3 SV=1 91 294 3.0E-16
sp|Q49V37|SYE_STAS1 Glutamate--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gltX PE=3 SV=1 88 379 4.0E-16
sp|B2TX02|SYE_SHIB3 Glutamate--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|Q83K84|SYE_SHIFL Glutamate--tRNA ligase OS=Shigella flexneri GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|Q0T2A3|SYE_SHIF8 Glutamate--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|Q2RJE3|SYE_MOOTA Glutamate--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=gltX PE=3 SV=1 89 300 4.0E-16
sp|A4W496|SYE_STRS2 Glutamate--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=gltX PE=3 SV=2 91 379 4.0E-16
sp|Q3YZD6|SYE_SHISS Glutamate--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|B6I6U7|SYE_ECOSE Glutamate--tRNA ligase OS=Escherichia coli (strain SE11) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|P04805|SYE_ECOLI Glutamate--tRNA ligase OS=Escherichia coli (strain K12) GN=gltX PE=1 SV=1 90 379 4.0E-16
sp|Q0TF64|SYE_ECOL5 Glutamate--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|A8A2Q2|SYE_ECOHS Glutamate--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|B1X9R9|SYE_ECODH Glutamate--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|A7ZPK7|SYE_ECO24 Glutamate--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|B1IX65|SYE_ECOLC Glutamate--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|Q8R7T1|SYE2_CALS4 Glutamate--tRNA ligase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX2 PE=3 SV=1 93 294 4.0E-16
sp|Q1R8W9|SYE_ECOUT Glutamate--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|Q8FFC9|SYE_ECOL6 Glutamate--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|A1ADS2|SYE_ECOK1 Glutamate--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=gltX PE=3 SV=1 90 379 4.0E-16
sp|Q8DFH5|SYE_VIBVU Glutamate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=gltX PE=3 SV=1 91 294 4.0E-16
sp|Q7MMW8|SYE_VIBVY Glutamate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=gltX PE=3 SV=1 91 294 4.0E-16
sp|Q1GEA9|SYE2_RUEST Glutamate--tRNA ligase 2 OS=Ruegeria sp. (strain TM1040) GN=gltX2 PE=3 SV=1 91 379 4.0E-16
sp|Q5ZU96|SYE_LEGPH Glutamate--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gltX PE=3 SV=2 91 399 5.0E-16
sp|Q5WVE0|SYE_LEGPL Glutamate--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=gltX PE=3 SV=1 91 399 5.0E-16
sp|B1LMJ5|SYE_ECOSM Glutamate--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gltX PE=3 SV=1 90 379 5.0E-16
sp|Q02W76|SYE_LACLS Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gltX PE=3 SV=1 90 379 5.0E-16
sp|Q9CDZ7|SYE_LACLA Glutamate--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gltX PE=3 SV=1 90 379 5.0E-16
sp|A4J0Y7|SYE_DESRM Glutamate--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=gltX PE=3 SV=1 91 300 5.0E-16
sp|Q03E40|SYE_PEDPA Glutamate--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gltX PE=3 SV=1 90 406 6.0E-16
sp|B5XVT8|SYE_KLEP3 Glutamate--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=gltX PE=3 SV=1 90 379 6.0E-16
sp|Q5NL22|SYE2_ZYMMO Glutamate--tRNA ligase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gltX2 PE=3 SV=1 91 201 6.0E-16
sp|B2VDY5|SYE_ERWT9 Glutamate--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gltX PE=3 SV=1 90 294 6.0E-16
sp|B3CST4|SYE2_ORITI Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX2 PE=3 SV=2 90 196 6.0E-16
sp|A5CD02|SYE1_ORITB Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX1 PE=3 SV=2 90 196 7.0E-16
sp|Q5PAG8|SYE2_ANAMM Glutamate--tRNA ligase 2 OS=Anaplasma marginale (strain St. Maries) GN=gltX2 PE=3 SV=2 90 208 7.0E-16
sp|A3PMJ1|SYE2_RHOS1 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gltX2 PE=3 SV=1 91 384 7.0E-16
sp|Q32DE6|SYE_SHIDS Glutamate--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gltX PE=3 SV=1 90 379 7.0E-16
sp|B5YZV2|SYE_ECO5E Glutamate--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gltX PE=3 SV=1 90 379 7.0E-16
sp|Q8XBN2|SYE_ECO57 Glutamate--tRNA ligase OS=Escherichia coli O157:H7 GN=gltX PE=3 SV=1 90 379 7.0E-16
sp|A4WD15|SYE_ENT38 Glutamate--tRNA ligase OS=Enterobacter sp. (strain 638) GN=gltX PE=3 SV=1 90 382 8.0E-16
sp|Q1MR60|SYE_LAWIP Glutamate--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gltX PE=3 SV=1 90 218 8.0E-16
sp|A6TC43|SYE_KLEP7 Glutamate--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gltX PE=3 SV=1 90 379 8.0E-16
sp|Q55778|SYE_SYNY3 Glutamate--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltX PE=3 SV=1 91 381 8.0E-16
sp|A5ID69|SYE_LEGPC Glutamate--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=gltX PE=3 SV=1 91 399 8.0E-16
sp|Q1QMM2|SYE_NITHX Glutamate--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gltX PE=3 SV=2 90 196 9.0E-16
sp|Q2GKT8|SYE2_ANAPZ Glutamate--tRNA ligase 2 OS=Anaplasma phagocytophilum (strain HZ) GN=gltX2 PE=3 SV=1 90 207 1.0E-15
sp|Q2NA91|SYE1_ERYLH Glutamate--tRNA ligase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=gltX1 PE=3 SV=2 88 294 1.0E-15
sp|A9ISS8|SYE2_BART1 Glutamate--tRNA ligase 2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX2 PE=3 SV=1 91 196 1.0E-15
sp|B0KCH7|SYE1_THEP3 Glutamate--tRNA ligase 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX1 PE=3 SV=1 93 294 1.0E-15
sp|A2RNK5|SYE_LACLM Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gltX PE=3 SV=1 90 379 1.0E-15
sp|B1I4Z1|SYE_DESAP Glutamate--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=gltX PE=3 SV=1 89 300 1.0E-15
sp|Q2NSC4|SYE_SODGM Glutamate--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=gltX PE=3 SV=1 90 294 1.0E-15
sp|B1LUJ9|SYE1_METRJ Glutamate--tRNA ligase 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gltX1 PE=3 SV=1 88 206 1.0E-15
sp|Q5LWB2|SYE1_RUEPO Glutamate--tRNA ligase 1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gltX1 PE=3 SV=1 91 206 1.0E-15
sp|Q5FRG7|SYE1_GLUOX Glutamate--tRNA ligase 1 OS=Gluconobacter oxydans (strain 621H) GN=gltX1 PE=3 SV=1 91 196 2.0E-15
sp|Q87RL6|SYE_VIBPA Glutamate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gltX PE=3 SV=1 91 292 2.0E-15
sp|A7MKV5|SYE_CROS8 Glutamate--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gltX PE=3 SV=1 90 379 2.0E-15
sp|Q3SRI7|SYE_NITWN Glutamate--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gltX PE=3 SV=2 91 196 2.0E-15
sp|Q1GUX4|SYE1_SPHAL Glutamate--tRNA ligase 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gltX1 PE=3 SV=1 91 336 2.0E-15
sp|Q89KR5|SYE_BRADU Glutamate--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gltX PE=3 SV=1 88 196 2.0E-15
sp|B3Q6P5|SYE_RHOPT Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=gltX PE=3 SV=1 91 196 2.0E-15
sp|B6JH82|SYE_OLICO Glutamate--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gltX PE=3 SV=1 88 196 2.0E-15
sp|A5G3W1|SYE_GEOUR Glutamate--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=gltX PE=3 SV=1 90 291 2.0E-15
sp|A8EY39|SYE1_RICCK Glutamate--tRNA ligase 1 OS=Rickettsia canadensis (strain McKiel) GN=gltX1 PE=3 SV=1 90 196 2.0E-15
sp|Q6G3V1|SYE2_BARHE Glutamate--tRNA ligase 2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX2 PE=3 SV=1 91 196 3.0E-15
sp|Q5HTB9|SYE2_CAMJR Glutamate--tRNA ligase 2 OS=Campylobacter jejuni (strain RM1221) GN=gltX2 PE=3 SV=1 89 212 3.0E-15
sp|A7H295|SYE1_CAMJD Glutamate--tRNA ligase 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gltX1 PE=3 SV=1 89 212 3.0E-15
sp|A8F2B0|SYE2_RICM5 Glutamate--tRNA ligase 2 OS=Rickettsia massiliae (strain Mtu5) GN=gltX2 PE=3 SV=1 88 196 3.0E-15
sp|O52914|SYE2_CAMJE Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gltX2 PE=3 SV=2 89 212 3.0E-15
sp|A1W0S2|SYE2_CAMJJ Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gltX2 PE=3 SV=1 89 212 3.0E-15
sp|A8FMZ3|SYE2_CAMJ8 Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gltX2 PE=3 SV=1 89 212 3.0E-15
sp|A7HY03|SYE2_PARL1 Glutamate--tRNA ligase 2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gltX2 PE=3 SV=1 91 196 3.0E-15
sp|A8GT27|SYE2_RICRS Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=gltX2 PE=3 SV=1 88 196 3.0E-15
sp|B0BUL7|SYE2_RICRO Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Iowa) GN=gltX2 PE=3 SV=1 88 196 3.0E-15
sp|Q6N5R5|SYE_RHOPA Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gltX PE=3 SV=1 91 196 4.0E-15
sp|Q92H06|SYE2_RICCN Glutamate--tRNA ligase 2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gltX2 PE=3 SV=1 88 196 4.0E-15
sp|Q5NP36|SYE1_ZYMMO Glutamate--tRNA ligase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gltX1 PE=3 SV=1 91 196 4.0E-15
sp|Q73HV5|SYE1_WOLPM Glutamate--tRNA ligase 1 OS=Wolbachia pipientis wMel GN=gltX1 PE=3 SV=1 91 208 4.0E-15
sp|B2IYI1|SYE_NOSP7 Glutamate--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gltX PE=3 SV=2 91 344 4.0E-15
sp|A6X0R0|SYE2_OCHA4 Glutamate--tRNA ligase 2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX2 PE=3 SV=1 91 185 4.0E-15
sp|Q6FZP6|SYE1_BARQU Glutamate--tRNA ligase 1 OS=Bartonella quintana (strain Toulouse) GN=gltX1 PE=3 SV=1 91 196 4.0E-15
sp|Q5X3Z5|SYE_LEGPA Glutamate--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=gltX PE=3 SV=1 91 379 4.0E-15
sp|B0U106|SYE_FRAP2 Glutamate--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gltX PE=3 SV=1 91 379 4.0E-15
sp|Q2RTZ4|SYE2_RHORT Glutamate--tRNA ligase 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gltX2 PE=3 SV=1 91 206 4.0E-15
sp|B0UQ09|SYE1_METS4 Glutamate--tRNA ligase 1 OS=Methylobacterium sp. (strain 4-46) GN=gltX1 PE=3 SV=1 90 196 5.0E-15
sp|Q82U77|SYE_NITEU Glutamate--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gltX PE=3 SV=1 91 294 5.0E-15
sp|Q5GSI3|SYE2_WOLTR Glutamate--tRNA ligase 2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gltX2 PE=3 SV=1 91 187 5.0E-15
sp|Q1IVP4|SYE1_KORVE Glutamate--tRNA ligase 1 OS=Koribacter versatilis (strain Ellin345) GN=gltX1 PE=3 SV=1 90 196 5.0E-15
sp|Q39UV7|SYE_GEOMG Glutamate--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gltX PE=3 SV=1 91 291 6.0E-15
sp|Q4UME8|SYE2_RICFE Glutamate--tRNA ligase 2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gltX2 PE=3 SV=1 91 196 7.0E-15
sp|P57173|SYE_BUCAI Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gltX PE=3 SV=1 90 294 7.0E-15
sp|A7MY61|SYE_VIBCB Glutamate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gltX PE=3 SV=1 91 292 8.0E-15
sp|Q8YHG4|SYE1_BRUME Glutamate--tRNA ligase 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX1 PE=3 SV=2 88 206 8.0E-15
sp|Q88YY0|SYE_LACPL Glutamate--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gltX PE=3 SV=1 90 379 8.0E-15
sp|B0CGU5|SYE2_BRUSI Glutamate--tRNA ligase 2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX2 PE=3 SV=1 88 206 8.0E-15
sp|A5VQR9|SYE2_BRUO2 Glutamate--tRNA ligase 2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX2 PE=3 SV=1 88 206 8.0E-15
sp|A9M5G0|SYE2_BRUC2 Glutamate--tRNA ligase 2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX2 PE=3 SV=1 88 206 8.0E-15
sp|Q57CZ2|SYE2_BRUAB Glutamate--tRNA ligase 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX2 PE=3 SV=1 88 206 8.0E-15
sp|Q2YRQ9|SYE2_BRUA2 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain 2308) GN=gltX2 PE=3 SV=1 88 206 8.0E-15
sp|B2S5Z7|SYE2_BRUA1 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain S19) GN=gltX2 PE=3 SV=1 88 206 8.0E-15
sp|Q8G0E8|SYE2_BRUSU Glutamate--tRNA ligase 2 OS=Brucella suis biovar 1 (strain 1330) GN=gltX2 PE=3 SV=1 88 206 9.0E-15
sp|A0RR62|SYE2_CAMFF Glutamate--tRNA ligase 2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gltX2 PE=3 SV=1 91 294 9.0E-15
sp|Q1D8Y1|SYE_MYXXD Glutamate--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=gltX PE=3 SV=1 94 379 9.0E-15
sp|Q47GG0|SYE_DECAR Glutamate--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=gltX PE=3 SV=1 91 294 9.0E-15
sp|Q4L3I7|SYE_STAHJ Glutamate--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gltX PE=3 SV=1 88 379 9.0E-15
sp|B0C8D6|SYE_ACAM1 Glutamate--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=gltX PE=3 SV=1 91 210 9.0E-15
sp|Q6AJL4|SYE_DESPS Glutamate--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gltX PE=3 SV=2 94 196 1.0E-14
sp|Q045X9|SYE_LACGA Glutamate--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gltX PE=3 SV=1 90 379 1.0E-14
sp|Q884C8|SYE_PSESM Glutamate--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gltX PE=3 SV=1 91 379 1.0E-14
sp|Q0P499|SYEM_DANRE Probable glutamate--tRNA ligase, mitochondrial OS=Danio rerio GN=ears2 PE=2 SV=1 76 379 1.0E-14
sp|Q1WSS4|SYE_LACS1 Glutamate--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=gltX PE=3 SV=1 89 379 1.0E-14
sp|A1USF5|SYE1_BARBK Glutamate--tRNA ligase 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gltX1 PE=3 SV=1 91 292 1.0E-14
sp|B1Z9T1|SYE1_METPB Glutamate--tRNA ligase 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX1 PE=3 SV=1 88 206 1.0E-14
sp|Q7WFA9|SYE_BORBR Glutamate--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gltX PE=3 SV=1 91 206 1.0E-14
sp|Q7W3X9|SYE_BORPA Glutamate--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gltX PE=3 SV=1 91 206 1.0E-14
sp|Q136B9|SYE_RHOPS Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=gltX PE=3 SV=1 91 196 1.0E-14
sp|Q4FQ04|SYE_PSYA2 Glutamate--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gltX PE=3 SV=1 91 381 1.0E-14
sp|Q2JRD6|SYE_SYNJA Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gltX PE=3 SV=1 90 336 1.0E-14
sp|Q16AX5|SYE1_ROSDO Glutamate--tRNA ligase 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gltX1 PE=3 SV=1 91 206 2.0E-14
sp|A9W910|SYE1_METEP Glutamate--tRNA ligase 1 OS=Methylobacterium extorquens (strain PA1) GN=gltX1 PE=3 SV=1 88 206 2.0E-14
sp|Q2GGL8|SYE2_EHRCR Glutamate--tRNA ligase 2 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gltX2 PE=3 SV=1 88 300 2.0E-14
sp|B0TBU3|SYE_HELMI Glutamate--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gltX PE=3 SV=1 89 294 2.0E-14
sp|Q48KA5|SYE_PSE14 Glutamate--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gltX PE=3 SV=1 91 379 2.0E-14
sp|A4WPH4|SYE1_RHOS5 Glutamate--tRNA ligase 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gltX1 PE=3 SV=1 91 379 2.0E-14
sp|Q11HT5|SYE2_CHESB Glutamate--tRNA ligase 2 OS=Chelativorans sp. (strain BNC1) GN=gltX2 PE=3 SV=1 91 206 2.0E-14
sp|B5E378|SYE_STRP4 Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gltX PE=3 SV=1 88 379 2.0E-14
sp|Q97NG1|SYE_STRPN Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gltX PE=1 SV=1 88 379 2.0E-14
sp|Q8YS86|SYE_NOSS1 Glutamate--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gltX PE=3 SV=1 91 210 2.0E-14
sp|Q5N1B8|SYE_SYNP6 Glutamate--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gltX PE=3 SV=1 90 210 2.0E-14
sp|Q8L1E5|SYE_SYNE7 Glutamate--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=gltX PE=3 SV=1 90 210 2.0E-14
sp|Q2W3G8|SYE2_MAGSA Glutamate--tRNA ligase 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gltX2 PE=3 SV=1 91 196 2.0E-14
sp|Q5FGW4|SYE2_EHRRG Glutamate--tRNA ligase 2 OS=Ehrlichia ruminantium (strain Gardel) GN=gltX2 PE=3 SV=1 89 208 2.0E-14
sp|Q7VUU5|SYE_BORPE Glutamate--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gltX PE=3 SV=1 93 206 2.0E-14
sp|Q839V7|SYE_ENTFA Glutamate--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gltX PE=3 SV=1 90 379 2.0E-14
sp|Q74L27|SYE_LACJO Glutamate--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gltX PE=3 SV=1 90 379 3.0E-14
sp|Q11I44|SYE1_CHESB Glutamate--tRNA ligase 1 OS=Chelativorans sp. (strain BNC1) GN=gltX1 PE=3 SV=1 91 196 3.0E-14
sp|Q28L59|SYE2_JANSC Glutamate--tRNA ligase 2 OS=Jannaschia sp. (strain CCS1) GN=gltX2 PE=3 SV=1 88 226 3.0E-14
sp|Q8CWN5|SYE_STRR6 Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gltX PE=3 SV=1 88 379 3.0E-14
sp|Q04IA3|SYE_STRP2 Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gltX PE=3 SV=1 88 379 3.0E-14
sp|Q8DVX9|SYE_STRMU Glutamate--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gltX PE=3 SV=1 88 379 3.0E-14
sp|A5VB94|SYE2_SPHWW Glutamate--tRNA ligase 2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gltX2 PE=3 SV=1 91 202 3.0E-14
sp|Q6FZN9|SYE2_BARQU Glutamate--tRNA ligase 2 OS=Bartonella quintana (strain Toulouse) GN=gltX2 PE=3 SV=1 91 292 3.0E-14
sp|A9W982|SYE2_METEP Glutamate--tRNA ligase 2 OS=Methylobacterium extorquens (strain PA1) GN=gltX2 PE=3 SV=1 92 201 3.0E-14
sp|P0DG35|SYE_STRPQ Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gltX PE=3 SV=1 88 379 3.0E-14
sp|P0DG34|SYE_STRP3 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gltX PE=3 SV=1 88 379 3.0E-14
sp|B2IGY0|SYE2_BEII9 Glutamate--tRNA ligase 2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX2 PE=3 SV=1 92 206 4.0E-14
sp|Q48VE5|SYE_STRPM Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|A2RCF4|SYE_STRPG Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|Q1JIQ6|SYE_STRPD Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|Q1JNK7|SYE_STRPC Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|P67024|SYE_STRP8 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|Q5XDZ4|SYE_STRP6 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|P67023|SYE_STRP1 Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=gltX PE=3 SV=1 88 379 4.0E-14
sp|Q6G3V8|SYE1_BARHE Glutamate--tRNA ligase 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX1 PE=3 SV=1 91 215 4.0E-14
sp|Q1Q845|SYE_PSYCK Glutamate--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=gltX PE=3 SV=1 91 381 4.0E-14
sp|A4XHE0|SYE1_CALS8 Glutamate--tRNA ligase 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX1 PE=3 SV=1 90 294 4.0E-14
sp|A1B0F1|SYE1_PARDP Glutamate--tRNA ligase 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=gltX1 PE=3 SV=1 91 381 4.0E-14
sp|Q5FQ35|SYE2_GLUOX Glutamate--tRNA ligase 2 OS=Gluconobacter oxydans (strain 621H) GN=gltX2 PE=3 SV=1 94 196 4.0E-14
sp|B2GAB3|SYE_LACF3 Glutamate--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gltX PE=3 SV=1 89 406 5.0E-14
sp|B1HNM5|SYE_LYSSC Glutamate--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=gltX PE=3 SV=1 88 379 5.0E-14
sp|Q8DLI5|SYE_THEEB Glutamate--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=gltX PE=1 SV=1 91 369 5.0E-14
sp|Q3IZQ8|SYE2_RHOS4 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gltX2 PE=3 SV=1 91 206 5.0E-14
sp|B5XJN3|SYE_STRPZ Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gltX PE=3 SV=1 88 379 5.0E-14
sp|A6VLT3|SYE_ACTSZ Glutamate--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gltX PE=3 SV=1 79 292 6.0E-14
sp|A8AUN5|SYE_STRGC Glutamate--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gltX PE=3 SV=1 91 379 6.0E-14
sp|B2IMY9|SYE_STRPS Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=gltX PE=3 SV=1 88 379 6.0E-14
sp|Q2KUY9|SYE_BORA1 Glutamate--tRNA ligase OS=Bordetella avium (strain 197N) GN=gltX PE=3 SV=1 91 206 6.0E-14
sp|B4U0R8|SYE_STREM Glutamate--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gltX PE=3 SV=1 88 379 6.0E-14
sp|Q15RR1|SYE_PSEA6 Glutamate--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gltX PE=3 SV=1 92 292 7.0E-14
sp|Q3YS31|SYE1_EHRCJ Glutamate--tRNA ligase 1 OS=Ehrlichia canis (strain Jake) GN=gltX1 PE=3 SV=1 88 263 7.0E-14
sp|A9I219|SYE_BORPD Glutamate--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gltX PE=3 SV=1 91 206 7.0E-14
sp|Q1J8L3|SYE_STRPF Glutamate--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gltX PE=3 SV=1 88 379 8.0E-14
sp|Q57DB3|SYE1_BRUAB Glutamate--tRNA ligase 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX1 PE=3 SV=1 91 193 8.0E-14
sp|Q2YQ56|SYE1_BRUA2 Glutamate--tRNA ligase 1 OS=Brucella abortus (strain 2308) GN=gltX1 PE=3 SV=1 91 193 8.0E-14
sp|B2S5M8|SYE1_BRUA1 Glutamate--tRNA ligase 1 OS=Brucella abortus (strain S19) GN=gltX1 PE=3 SV=1 91 193 8.0E-14
sp|Q7NWP4|SYE_CHRVO Glutamate--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gltX PE=3 SV=1 91 206 8.0E-14
sp|Q46GU9|SYE_PROMT Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=gltX PE=3 SV=1 90 210 9.0E-14
sp|Q2IL38|SYE_ANADE Glutamate--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gltX PE=3 SV=1 89 196 1.0E-13
sp|Q4ZV02|SYE_PSEU2 Glutamate--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gltX PE=3 SV=1 91 379 1.0E-13
sp|Q6D206|SYE_PECAS Glutamate--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gltX PE=3 SV=1 90 294 1.0E-13
sp|B4UI79|SYE_ANASK Glutamate--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=gltX PE=3 SV=1 89 196 1.0E-13
sp|Q0AUF7|SYE2_SYNWW Glutamate--tRNA ligase 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX2 PE=3 SV=1 89 300 1.0E-13
sp|Q3M3H8|SYE_ANAVT Glutamate--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gltX PE=3 SV=1 91 336 1.0E-13
sp|A1JLB3|SYE_YERE8 Glutamate--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gltX PE=3 SV=1 90 294 1.0E-13
sp|B5YEP5|SYE_DICT6 Glutamate--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gltX PE=3 SV=1 89 294 1.0E-13
sp|A7H9S6|SYE_ANADF Glutamate--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=gltX PE=3 SV=1 89 196 1.0E-13
sp|A5V932|SYE1_SPHWW Glutamate--tRNA ligase 1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gltX1 PE=3 SV=1 91 206 1.0E-13
sp|B4EZQ7|SYE_PROMH Glutamate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=gltX PE=3 SV=1 90 214 1.0E-13
sp|A4XLI3|SYE2_CALS8 Glutamate--tRNA ligase 2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX2 PE=3 SV=1 91 312 1.0E-13
sp|Q2IW96|SYE_RHOP2 Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=gltX PE=3 SV=1 91 196 1.0E-13
sp|Q668N0|SYE_YERPS Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gltX PE=3 SV=1 90 294 1.0E-13
sp|B2K913|SYE_YERPB Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gltX PE=3 SV=1 90 294 1.0E-13
sp|A9ISQ6|SYE1_BART1 Glutamate--tRNA ligase 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX1 PE=3 SV=1 91 206 1.0E-13
sp|B1JFZ4|SYE_YERPY Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gltX PE=3 SV=1 90 294 1.0E-13
sp|A7FGC6|SYE_YERP3 Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gltX PE=3 SV=1 90 294 1.0E-13
sp|Q9K1R6|SYE_NEIMB Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gltX PE=3 SV=1 91 379 1.0E-13
sp|Q5F5J8|SYE_NEIG1 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q1LT18|SYE_BAUCH Glutamate--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gltX PE=3 SV=1 91 294 2.0E-13
sp|P75114|SYE_MYCPN Glutamate--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gltX PE=3 SV=1 89 379 2.0E-13
sp|B3WA39|SYE_LACCB Glutamate--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q035R5|SYE_LACC3 Glutamate--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|B4RPQ3|SYE_NEIG2 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q1RJC6|SYE2_RICBR Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain RML369-C) GN=gltX2 PE=3 SV=1 88 196 2.0E-13
sp|A8GX08|SYE2_RICB8 Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain OSU 85-389) GN=gltX2 PE=3 SV=2 88 196 2.0E-13
sp|B1ZAR5|SYE2_METPB Glutamate--tRNA ligase 2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX2 PE=3 SV=1 92 201 2.0E-13
sp|Q4KF16|SYE_PSEF5 Glutamate--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q8G0S1|SYE1_BRUSU Glutamate--tRNA ligase 1 OS=Brucella suis biovar 1 (strain 1330) GN=gltX1 PE=3 SV=1 91 185 2.0E-13
sp|A9MB31|SYE1_BRUC2 Glutamate--tRNA ligase 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX1 PE=3 SV=1 91 185 2.0E-13
sp|B2UST7|SYE1_HELPS Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain Shi470) GN=gltX1 PE=3 SV=1 91 291 2.0E-13
sp|B0USJ3|SYE_HISS2 Glutamate--tRNA ligase OS=Histophilus somni (strain 2336) GN=gltX PE=3 SV=1 79 292 2.0E-13
sp|Q65VB3|SYE_MANSM Glutamate--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gltX PE=3 SV=3 79 379 2.0E-13
sp|Q0I297|SYE_HAES1 Glutamate--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=gltX PE=3 SV=1 79 292 2.0E-13
sp|Q6LTT8|SYE_PHOPR Glutamate--tRNA ligase OS=Photobacterium profundum GN=gltX PE=3 SV=1 91 210 2.0E-13
sp|Q03IP7|SYE_STRTD Glutamate--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q5M2K1|SYE_STRT2 Glutamate--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q5LXZ7|SYE_STRT1 Glutamate--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|B0CGG7|SYE1_BRUSI Glutamate--tRNA ligase 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX1 PE=3 SV=1 91 185 2.0E-13
sp|A5VQF9|SYE1_BRUO2 Glutamate--tRNA ligase 1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX1 PE=3 SV=2 91 185 2.0E-13
sp|A0Q4G6|SYE_FRATN Glutamate--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|A4IZU9|SYE_FRATW Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|B2SE01|SYE_FRATM Glutamate--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|A8GPB2|SYE2_RICAH Glutamate--tRNA ligase 2 OS=Rickettsia akari (strain Hartford) GN=gltX2 PE=3 SV=1 91 196 2.0E-13
sp|Q8YH36|SYE2_BRUME Glutamate--tRNA ligase 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX2 PE=3 SV=2 91 185 2.0E-13
sp|Q0BNU3|SYE_FRATO Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q2A5I8|SYE_FRATH Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|A7N9Q8|SYE_FRATF Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|B0KF73|SYE_PSEPG Glutamate--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|A9LZH6|SYE_NEIM0 Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gltX PE=3 SV=1 91 379 2.0E-13
sp|Q2YSD3|SYE_STAAB Glutamate--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gltX PE=3 SV=1 88 379 3.0E-13
sp|Q68WB4|SYE2_RICTY Glutamate--tRNA ligase 2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gltX2 PE=3 SV=1 91 196 3.0E-13
sp|Q1GNX2|SYE2_SPHAL Glutamate--tRNA ligase 2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gltX2 PE=3 SV=1 91 228 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0000166 nucleotide binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0005737 cytoplasm Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0005524 ATP binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0043436 oxoacid metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043038 amino acid activation No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0005575 cellular_component No
GO:0017076 purine nucleotide binding No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5591
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3279
Ophiocordyceps australis map64 (Brazil) OphauB2|5523
Ophiocordyceps camponoti-floridani Ophcf2|05561
Ophiocordyceps camponoti-rufipedis Ophun1|4948 (this protein)
Ophiocordyceps kimflemingae Ophio5|4451
Ophiocordyceps subramaniannii Hirsu2|7506

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4948
MADDVSQPMAKLQLDEETGEMVSKSELKKRQQKRAKKAAQEKARQEKAAAEPSTRAAAPAQKPEETPMDPDAMFK
QGFLDDVYKERPSDKVVTRFPPEPNGYLHIGHAKAIAVNFGFARHHGGVCYLRYDDTNPEKEEEQYFTAIKDVVQ
WLGFEPFKVTYSSDNFGKLYDMAEKLVMLGKAYVCACTDVELKDQRGGEKGAHPRYRCQHAEQSVDDNLTKFRAM
RDGKYKPKEVFLRMKQDIVDNNPQMWDLAAYRIKTDTPHHRTGRDWVIYPTYDFAHCLCDSFEGITHSLCTTEFI
LSRVSYEWLNKTLEVYEPMQREYGRLNLTGTVLSKRKIIKLVEEKIVRSWDDPRLYTLMAIRRRGVPPGAILEFV
NELGVTTNITAIQIKRFEQSVRKYLEKTVPRLMMVLDPVPLVIDGAEALDLDLPFSPKDPKMGSHTVKFTPTVYI
DREDFREVDSKDYFRLAPGKTVGLLNVPFPVKAVSFSKDPTTGKVTEIRGVFDKEAKRPKTYIQWVGTEGTRKVE
ARIHNPLFKSEKPNDAEGGYLNDINPDSEVIYPEAVIESGLDEVRRRAPWPEAAGESELGRGGPESVRFQAMRVA
YFAMDSDSSDDKIVLNRIVSLKEDAGKRL*
Coding >Ophun1|4948
ATGGCCGACGACGTCTCTCAACCAATGGCCAAGCTCCAACTCGACGAGGAGACGGGCGAGATGGTCTCCAAGTCG
GAGCTGAAGAAGCGCCAGCAGAAACGAGCCAAGAAAGCAGCCCAAGAAAAGGCACGACAAGAAAAAGCAGCTGCA
GAGCCGTCGACTCGAGCTGCGGCGCCGGCGCAAAAACCAGAAGAGACGCCCATGGACCCAGACGCCATGTTCAAG
CAGGGCTTCCTCGACGACGTATACAAGGAGCGCCCTTCCGACAAGGTCGTGACCAGATTCCCGCCCGAGCCCAAC
GGCTATCTTCACATTGGTCACGCCAAGGCGATTGCTGTCAACTTTGGATTCGCCAGGCATCACGGTGGCGTGTGT
TATCTGCGCTACGACGACACCAATCCGGAGAAGGAGGAGGAGCAGTACTTTACCGCCATCAAGGACGTGGTGCAG
TGGCTCGGGTTTGAGCCCTTCAAGGTTACCTACTCGAGTGATAACTTTGGGAAGCTCTACGACATGGCTGAGAAG
CTGGTGATGCTGGGCAAGGCTTACGTCTGCGCCTGTACTGACGTCGAGCTCAAGGACCAACGCGGAGGCGAAAAG
GGCGCGCATCCCCGATACCGCTGTCAACACGCCGAGCAGTCCGTCGACGATAATCTGACCAAGTTCAGAGCCATG
CGAGACGGCAAGTACAAGCCCAAGGAGGTGTTTCTCCGCATGAAACAGGATATTGTCGACAACAATCCCCAGATG
TGGGATCTGGCCGCCTATCGAATCAAGACGGACACGCCCCATCACCGCACGGGTCGAGACTGGGTCATCTATCCG
ACGTACGACTTTGCTCACTGCCTGTGCGACAGCTTCGAGGGCATCACGCACTCGCTCTGCACTACCGAGTTCATT
CTCAGCCGAGTCTCATACGAATGGCTCAACAAGACGCTCGAGGTTTATGAGCCGATGCAGAGGGAATACGGCCGG
CTCAACCTGACTGGCACCGTCCTGTCCAAGAGAAAGATTATCAAGCTCGTCGAGGAAAAGATTGTGCGCAGCTGG
GACGATCCGCGGCTGTACACGCTCATGGCCATCCGTCGGCGCGGCGTGCCTCCAGGCGCCATCCTCGAGTTCGTC
AACGAGCTGGGCGTCACCACCAACATCACGGCGATCCAGATCAAGCGGTTCGAGCAGAGCGTGCGCAAGTACCTG
GAGAAGACGGTGCCCCGGCTGATGATGGTGCTCGACCCGGTGCCGTTGGTGATTGACGGCGCCGAGGCACTGGAT
CTCGACCTTCCCTTTTCCCCCAAGGACCCCAAGATGGGCTCACATACCGTCAAGTTTACGCCGACCGTCTACATC
GACAGGGAAGACTTCAGAGAAGTGGACAGCAAGGACTACTTCCGCCTCGCTCCCGGCAAGACGGTTGGCCTCCTC
AATGTCCCTTTTCCGGTCAAGGCCGTCTCCTTCAGCAAGGACCCGACCACGGGCAAAGTTACAGAGATTCGCGGC
GTCTTTGACAAGGAGGCCAAGAGGCCCAAGACGTACATCCAATGGGTCGGGACCGAGGGCACGAGAAAGGTCGAG
GCTCGCATCCACAACCCGCTCTTCAAGTCGGAGAAGCCCAACGACGCCGAGGGCGGGTACCTCAACGACATCAAT
CCGGACAGCGAGGTCATCTACCCCGAAGCCGTGATCGAGTCGGGTCTTGATGAGGTTAGGAGGCGCGCGCCGTGG
CCAGAGGCGGCTGGAGAGAGTGAGCTCGGGAGGGGGGGGCCTGAGAGTGTGAGGTTCCAGGCGATGCGGGTGGCG
TACTTTGCCATGGATTCGGACAGCTCAGACGACAAGATTGTGCTGAACCGTATCGTGAGCTTAAAGGAGGACGCG
GGCAAGAGGCTGTGA
Transcript >Ophun1|4948
ATGGCCGACGACGTCTCTCAACCAATGGCCAAGCTCCAACTCGACGAGGAGACGGGCGAGATGGTCTCCAAGTCG
GAGCTGAAGAAGCGCCAGCAGAAACGAGCCAAGAAAGCAGCCCAAGAAAAGGCACGACAAGAAAAAGCAGCTGCA
GAGCCGTCGACTCGAGCTGCGGCGCCGGCGCAAAAACCAGAAGAGACGCCCATGGACCCAGACGCCATGTTCAAG
CAGGGCTTCCTCGACGACGTATACAAGGAGCGCCCTTCCGACAAGGTCGTGACCAGATTCCCGCCCGAGCCCAAC
GGCTATCTTCACATTGGTCACGCCAAGGCGATTGCTGTCAACTTTGGATTCGCCAGGCATCACGGTGGCGTGTGT
TATCTGCGCTACGACGACACCAATCCGGAGAAGGAGGAGGAGCAGTACTTTACCGCCATCAAGGACGTGGTGCAG
TGGCTCGGGTTTGAGCCCTTCAAGGTTACCTACTCGAGTGATAACTTTGGGAAGCTCTACGACATGGCTGAGAAG
CTGGTGATGCTGGGCAAGGCTTACGTCTGCGCCTGTACTGACGTCGAGCTCAAGGACCAACGCGGAGGCGAAAAG
GGCGCGCATCCCCGATACCGCTGTCAACACGCCGAGCAGTCCGTCGACGATAATCTGACCAAGTTCAGAGCCATG
CGAGACGGCAAGTACAAGCCCAAGGAGGTGTTTCTCCGCATGAAACAGGATATTGTCGACAACAATCCCCAGATG
TGGGATCTGGCCGCCTATCGAATCAAGACGGACACGCCCCATCACCGCACGGGTCGAGACTGGGTCATCTATCCG
ACGTACGACTTTGCTCACTGCCTGTGCGACAGCTTCGAGGGCATCACGCACTCGCTCTGCACTACCGAGTTCATT
CTCAGCCGAGTCTCATACGAATGGCTCAACAAGACGCTCGAGGTTTATGAGCCGATGCAGAGGGAATACGGCCGG
CTCAACCTGACTGGCACCGTCCTGTCCAAGAGAAAGATTATCAAGCTCGTCGAGGAAAAGATTGTGCGCAGCTGG
GACGATCCGCGGCTGTACACGCTCATGGCCATCCGTCGGCGCGGCGTGCCTCCAGGCGCCATCCTCGAGTTCGTC
AACGAGCTGGGCGTCACCACCAACATCACGGCGATCCAGATCAAGCGGTTCGAGCAGAGCGTGCGCAAGTACCTG
GAGAAGACGGTGCCCCGGCTGATGATGGTGCTCGACCCGGTGCCGTTGGTGATTGACGGCGCCGAGGCACTGGAT
CTCGACCTTCCCTTTTCCCCCAAGGACCCCAAGATGGGCTCACATACCGTCAAGTTTACGCCGACCGTCTACATC
GACAGGGAAGACTTCAGAGAAGTGGACAGCAAGGACTACTTCCGCCTCGCTCCCGGCAAGACGGTTGGCCTCCTC
AATGTCCCTTTTCCGGTCAAGGCCGTCTCCTTCAGCAAGGACCCGACCACGGGCAAAGTTACAGAGATTCGCGGC
GTCTTTGACAAGGAGGCCAAGAGGCCCAAGACGTACATCCAATGGGTCGGGACCGAGGGCACGAGAAAGGTCGAG
GCTCGCATCCACAACCCGCTCTTCAAGTCGGAGAAGCCCAACGACGCCGAGGGCGGGTACCTCAACGACATCAAT
CCGGACAGCGAGGTCATCTACCCCGAAGCCGTGATCGAGTCGGGTCTTGATGAGGTTAGGAGGCGCGCGCCGTGG
CCAGAGGCGGCTGGAGAGAGTGAGCTCGGGAGGGGGGGGCCTGAGAGTGTGAGGTTCCAGGCGATGCGGGTGGCG
TACTTTGCCATGGATTCGGACAGCTCAGACGACAAGATTGTGCTGAACCGTATCGTGAGCTTAAAGGAGGACGCG
GGCAAGAGGCTGTGA
Gene >Ophun1|4948
ATGGCCGACGACGTCTCTCAACCAATGGCCAAGCTCCAACTCGACGAGGAGACGGGCGAGATGGTCTCCAAGTCG
GAGCTGAAGAAGCGCCAGCAGAAACGAGCCAAGAAAGCAGCCCAAGAAAAGGCACGACAAGAAAAAGCAGCTGCA
GAGCCGTCGACTCGAGCTGCGGCGCCGGCGCAAAAACCAGAAGAGACGCCCATGGACCCAGACGCCATGTTCAAG
CAGGGCTTCCTCGACGACGTATACAAGGAGCGCCCTTCCGACAAGGTCGTGACCAGATTCCCGCCCGAGCCCAAC
GGCTATCTTCACATTGGTCACGCCAAGGCGATTGCTGTCAACTTTGGATTCGCCAGGCATCACGGTGGCGTGTGT
TATCTGCGCTACGACGACACCAATCCGGAGAAGGAGGAGGAGCAGTACTTTACCGCCATCAAGGACGTGGTGCAG
TGGCTCGGGTTTGAGCCCTTCAAGGTTACCTACTCGAGTGATAACTTTGGGAAGCTCTACGACATGGCTGAGAAG
CTGGTGATGCTGGGCAAGGCTTACGTCTGCGCCTGTACTGGTGAGGGCAACTCGTCTCGATGGATACCGTCCTTT
GGCTGATCAACCCTTACTTAGACGTCGAGCTCAAGGACCAACGCGGAGGCGAAAAGGGCGCGCATCCCCGATACC
GCTGTCAACACGCCGAGCAGTCCGTCGACGATAATCTGACCAAGTTCAGAGCCATGCGAGACGGCAAGTACAAGC
CCAAGGAGGTGTTTCTCCGCATGAAACAGGATATTGTCGACAACAATCCCCAGATGTGGGATCTGGCCGCCTATC
GAATCAAGACGGACACGCCCCATCACCGCACGGGTCGAGACTGGGTCATCTATCCGACGTACGACTTTGCTCACT
GCCTGTGCGACAGCTTCGAGGGCATCACGCACTCGCTCTGCACTACCGAGTTCATTCTCAGCCGAGTCTCATACG
AATGGCTCAACAAGACGCTCGAGGTTTATGAGCCGATGCAGAGGGAATACGGCCGGCTCAACCTGACTGGCACCG
TCCTGTCCAAGAGAAAGATTATCAAGCTCGTCGAGGAAAAGATTGTGCGCAGCTGGGACGATCCGCGGCTGTACA
CGCTCATGGCCATCCGTCGGCGCGGCGTGCCTCCAGGCGCCATCCTCGAGTTCGTCAACGAGCTGGGCGTCACCA
CCAACATCACGGCGATCCAGATCAAGCGGTTCGAGCAGAGCGTGCGCAAGTACCTGGAGAAGACGGTGCCCCGGC
TGATGATGGTGCTCGACCCGGTGCCGTTGGTGATTGACGGCGCCGAGGCACTGGATCTCGACCTTCCCTTTTCCC
CCAAGGACCCCAAGATGGGCTCACATACCGTCAAGTTTACGCCGACCGTCTACATCGACAGGGAAGACTTCAGAG
AAGTGGACAGCAAGGACTACTTCCGCCTCGCTCCCGGCAAGACGGTTGGCCTCCTCAATGTCCCTTTTCCGGTCA
AGGCCGTCTCCTTCAGCAAGGACCCGACCACGGGCAAAGTTACAGAGATTCGCGGCGTCTTTGACAAGGAGGCCA
AGAGGCCCAAGACGTACATCCAATGGGTCGGGACCGAGGGCACGAGAAAGGTCGAGGCTCGCATCCACAACCCGC
TCTTCAAGTCGGAGAAGCCCAACGACGCCGAGGGCGGGTACCTCAACGACATCAATCCGGACAGCGAGGTCATCT
ACCCCGAAGCCGTGATCGAGTCGGGTCTTGATGAGGTTAGGAGGCGCGCGCCGTGGCCAGAGGCGGCTGGAGAGA
GTGAGCTCGGGAGGGGGGGGCCTGAGAGTGTGAGGTTCCAGGCGATGCGGGTGGCGTACTTTGTGAGTTTCCTTC
TAAGCGGTTCCGCTCTTTACTGACAGATGTCGTACAGGCCATGGATTCGGACAGCTCAGACGACAAGATTGTGCT
GAACCGTATCGTGAGCTTAAAGGAGGACGCGGGCAAGAGGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail