Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4944
Gene name
LocationContig_47:30461..31514
Strand-
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60024|ALL4_ASPFU Allergen Asp f 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03830 PE=1 SV=2 2 337 1.0E-23

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.996179

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5300
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2018
Ophiocordyceps australis map64 (Brazil) OphauB2|5519
Ophiocordyceps camponoti-floridani Ophcf2|05565
Ophiocordyceps camponoti-rufipedis Ophun1|4944 (this protein)
Ophiocordyceps kimflemingae Ophio5|4446
Ophiocordyceps subramaniannii Hirsu2|4791

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4944
MVNIKTSVSTLLVAAALGVVAHPSAHGHGHRHFHRAVAKNADINQNTYGTQYTKSVHRVNDVADKSHKAPPPSPK
EDSVAASPPAVPAQVKNVLSDTLPAQTAQQSQPAGQAQQGGSTGTGASSYEDFCTGSKSKRATNLQVATAGNLGG
PGDMYGCNLKLIQSNIADKYNNTVRFDNAGDNTQACVCWLKIGPDRVSVNGFFKDNKVLSFNIPPKGQQYLAVQE
DSKGGCSCYKDQVPLTVNGQFAGTWLEFDMASRANGGCSGADASSLVAHSSNMDVPGLKVCEDKNLKDDSCSIIY
AGGKGNKLSYPGGTENADGLSVNLQPGPARFIATVDYAGPAPANAVNPTR*
Coding >Ophun1|4944
ATGGTTAACATCAAGACTTCCGTCTCGACCCTCCTCGTGGCTGCGGCCCTCGGTGTCGTCGCTCATCCCAGCGCT
CACGGTCACGGTCATCGCCACTTCCACCGCGCCGTCGCTAAAAACGCCGACATCAACCAAAACACCTACGGCACT
CAATACACCAAGTCGGTGCACCGCGTCAACGACGTGGCGGACAAGAGCCACAAGGCTCCTCCGCCCTCTCCCAAG
GAGGATTCCGTCGCCGCCTCGCCTCCCGCCGTCCCTGCTCAGGTCAAGAACGTCTTGTCCGACACCCTGCCGGCC
CAGACCGCGCAGCAGTCGCAGCCCGCTGGCCAGGCTCAGCAAGGTGGCAGCACCGGCACTGGCGCCTCCTCTTAC
GAGGACTTTTGCACCGGCTCCAAGTCGAAGCGAGCAACCAATCTTCAGGTCGCCACCGCGGGCAACCTCGGGGGC
CCGGGCGACATGTACGGCTGCAACTTGAAGCTCATCCAGAGCAACATCGCCGACAAGTACAACAACACGGTCCGC
TTCGACAACGCCGGCGACAACACGCAGGCCTGCGTGTGCTGGCTCAAGATTGGCCCCGACCGAGTGTCGGTCAAC
GGTTTCTTCAAGGATAACAAGGTGCTCAGTTTCAACATCCCCCCCAAGGGTCAGCAGTACCTCGCCGTCCAGGAG
GACTCCAAAGGTGGCTGCTCCTGCTACAAGGACCAGGTGCCCCTCACCGTCAACGGCCAGTTCGCCGGCACCTGG
CTCGAGTTCGACATGGCAAGCAGGGCCAATGGCGGCTGCTCGGGCGCCGACGCCTCGTCCTTGGTCGCTCATTCG
AGTAACATGGACGTTCCAGGCCTGAAGGTGTGCGAGGACAAGAACCTCAAGGACGATTCGTGCTCCATCATCTAC
GCCGGCGGCAAGGGCAACAAGCTGTCTTACCCCGGCGGCACCGAGAACGCCGACGGCCTCAGCGTCAACCTGCAG
CCCGGTCCGGCTCGCTTCATCGCCACCGTCGACTACGCGGGGCCGGCGCCGGCCAACGCTGTGAACCCTACGCGG
TGA
Transcript >Ophun1|4944
ATGGTTAACATCAAGACTTCCGTCTCGACCCTCCTCGTGGCTGCGGCCCTCGGTGTCGTCGCTCATCCCAGCGCT
CACGGTCACGGTCATCGCCACTTCCACCGCGCCGTCGCTAAAAACGCCGACATCAACCAAAACACCTACGGCACT
CAATACACCAAGTCGGTGCACCGCGTCAACGACGTGGCGGACAAGAGCCACAAGGCTCCTCCGCCCTCTCCCAAG
GAGGATTCCGTCGCCGCCTCGCCTCCCGCCGTCCCTGCTCAGGTCAAGAACGTCTTGTCCGACACCCTGCCGGCC
CAGACCGCGCAGCAGTCGCAGCCCGCTGGCCAGGCTCAGCAAGGTGGCAGCACCGGCACTGGCGCCTCCTCTTAC
GAGGACTTTTGCACCGGCTCCAAGTCGAAGCGAGCAACCAATCTTCAGGTCGCCACCGCGGGCAACCTCGGGGGC
CCGGGCGACATGTACGGCTGCAACTTGAAGCTCATCCAGAGCAACATCGCCGACAAGTACAACAACACGGTCCGC
TTCGACAACGCCGGCGACAACACGCAGGCCTGCGTGTGCTGGCTCAAGATTGGCCCCGACCGAGTGTCGGTCAAC
GGTTTCTTCAAGGATAACAAGGTGCTCAGTTTCAACATCCCCCCCAAGGGTCAGCAGTACCTCGCCGTCCAGGAG
GACTCCAAAGGTGGCTGCTCCTGCTACAAGGACCAGGTGCCCCTCACCGTCAACGGCCAGTTCGCCGGCACCTGG
CTCGAGTTCGACATGGCAAGCAGGGCCAATGGCGGCTGCTCGGGCGCCGACGCCTCGTCCTTGGTCGCTCATTCG
AGTAACATGGACGTTCCAGGCCTGAAGGTGTGCGAGGACAAGAACCTCAAGGACGATTCGTGCTCCATCATCTAC
GCCGGCGGCAAGGGCAACAAGCTGTCTTACCCCGGCGGCACCGAGAACGCCGACGGCCTCAGCGTCAACCTGCAG
CCCGGTCCGGCTCGCTTCATCGCCACCGTCGACTACGCGGGGCCGGCGCCGGCCAACGCTGTGAACCCTACGCGG
TGA
Gene >Ophun1|4944
ATGGTTAACATCAAGACTTCCGTCTCGACCCTCCTCGTGGCTGCGGCCCTCGGTGTCGTCGCTCATCCCAGCGCT
CACGGTCACGGTCATCGCCACTTCCACCGCGCCGTCGCTAAAAACGCCGACATCAACCAAAACACCTACGGCACT
CAATACACCAAGTCGGTGCACCGCGTCAACGACGTGGCGGACAAGAGCCACAAGGCTCCTCCGCCCTCTCCCAAG
GAGGATTCCGTCGCCGCCTCGCCTCCCGCCGTCCCTGCTCAGGTCAAGAACGTCTTGTCCGACACCCTGCCGGCC
CAGACCGCGCAGCAGTCGCAGCCCGCTGGCCAGGCTCAGCAAGGTGGCAGCACCGGCACTGGCGCCTCCTCTTAC
GAGGACTTTTGCACCGGCTCCAAGTCGAAGCGAGCAACCAATCTTCAGGTCGCCACCGCGGGCAACCTCGGGGGC
CCGGGCGACATGTACGGCTGCAACTTGAAGCTCATCCAGAGCAACATCGCCGACAAGTACAACAACACGGTCCGC
TTCGACAACGCCGGCGACAACACGCAGGCCTGCGTGTGCTGGCTCAAGATTGGCCCCGACCGAGTGTCGGTCAAC
GGTTTCTTCAAGGATAACAAGGTGCTCAGTTTCAACATCCCCCCCAAGGGTCAGCAGTACCTCGCCGTCCAGGAG
GACTCCAAAGGTGGCTGCTCCTGCTACAAGGACCAGGTGCCCCTCACCGTCAACGGCCAGTTCGCCGGCACCTGG
CTCGAGTTCGACATGGCAAGCAGGGCCAATGGCGGCTGCTCGGGCGCCGACGCCTCGTCCTTGGTCGCTCATTCG
AGTAACATGGACGTTCCAGGCCTGAAGGTGTGCGAGGACAAGAACCTCAAGGACGATTCGTGCTCCATCATCTAC
GCCGGCGGCAAGGGCAACAAGCTGTCTTACCCCGGCGGCACCGAGAACGCCGACGGCCTCAGCGTCAACCTGCAG
CCCGGTCCGGCTCGCTTCATCGCCACCGTCGACTACGCGGGGCCGGCGCCGGCCAACGCTGTGAACCCTACGCGG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail