Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4938
Gene name
LocationContig_47:18320..20180
Strand+
Gene length (bp)1860
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 7.6E-74 56 494
PF07690 MFS_1 Major Facilitator Superfamily 3.7E-22 60 429

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 54 494 9.0E-53
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 52 524 8.0E-49
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 42 492 5.0E-47
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 49 492 8.0E-47
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 37 492 4.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 54 494 9.0E-53
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 52 524 8.0E-49
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 42 492 5.0E-47
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 49 492 8.0E-47
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 37 492 4.0E-46
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 37 492 4.0E-46
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 57 492 3.0E-45
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 45 492 4.0E-45
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 45 492 4.0E-45
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 53 492 7.0E-45
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 58 492 9.0E-45
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 47 493 6.0E-43
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 57 493 7.0E-43
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 57 495 8.0E-42
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 50 517 1.0E-41
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 49 496 3.0E-41
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 57 505 1.0E-40
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 50 497 1.0E-40
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 32 513 1.0E-40
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 58 508 2.0E-40
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 57 493 5.0E-40
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 42 495 2.0E-39
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 33 393 3.0E-39
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 50 495 1.0E-38
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 57 497 2.0E-38
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 50 495 3.0E-38
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 50 385 4.0E-38
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 82 495 1.0E-37
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 58 499 2.0E-37
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 58 499 2.0E-37
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 92 507 5.0E-37
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 91 494 6.0E-37
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 66 492 1.0E-36
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 94 497 2.0E-36
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 50 494 5.0E-36
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 58 497 1.0E-35
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 50 494 1.0E-35
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 50 385 1.0E-35
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 53 497 2.0E-35
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 50 385 8.0E-35
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 50 498 8.0E-35
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 85 491 1.0E-34
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 50 494 2.0E-34
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 82 496 3.0E-34
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 50 505 6.0E-34
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 91 497 9.0E-34
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 86 491 2.0E-33
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 127 497 3.0E-33
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 58 381 5.0E-33
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 53 516 9.0E-33
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 46 492 1.0E-32
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 58 381 2.0E-32
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 80 492 2.0E-31
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 58 494 3.0E-31
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 80 492 4.0E-31
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 82 494 4.0E-31
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 37 492 4.0E-31
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 50 507 1.0E-30
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 39 492 2.0E-30
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 21 359 3.0E-30
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 91 497 5.0E-30
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 25 492 5.0E-30
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 80 492 6.0E-30
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 54 496 6.0E-30
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 55 494 7.0E-30
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 53 497 7.0E-30
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 44 492 8.0E-30
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 56 505 2.0E-29
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 109 491 2.0E-29
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 20 359 2.0E-29
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 53 495 3.0E-29
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 54 497 3.0E-29
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 82 499 4.0E-29
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 27 492 5.0E-29
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 41 389 5.0E-29
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 21 359 1.0E-28
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 35 499 1.0E-28
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 106 491 2.0E-28
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 82 501 2.0E-28
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 6 494 4.0E-28
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 58 497 5.0E-28
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 115 497 6.0E-28
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 16 507 8.0E-28
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 23 359 1.0E-27
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 53 512 1.0E-27
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 56 506 1.0E-27
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 51 492 1.0E-27
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 132 497 2.0E-27
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 50 492 2.0E-27
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 115 495 2.0E-27
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 6 507 2.0E-27
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 61 497 3.0E-27
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 53 497 3.0E-27
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 27 492 3.0E-27
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 27 492 3.0E-27
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 27 492 4.0E-27
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 53 494 4.0E-27
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 53 518 7.0E-27
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 53 518 1.0E-26
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 27 492 1.0E-26
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 53 518 1.0E-26
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 21 496 1.0E-26
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 27 492 2.0E-26
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 56 492 2.0E-26
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 27 492 3.0E-26
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 58 496 3.0E-26
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 52 513 3.0E-26
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 52 498 4.0E-26
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 48 492 4.0E-26
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 48 492 4.0E-26
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 50 492 4.0E-26
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 53 507 5.0E-26
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 79 492 5.0E-26
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 50 492 6.0E-26
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 49 491 7.0E-26
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 27 492 1.0E-25
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 53 492 2.0E-25
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 27 492 3.0E-25
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 55 496 3.0E-25
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 52 492 3.0E-25
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 53 516 3.0E-25
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 53 507 4.0E-25
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 55 359 4.0E-25
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 53 507 5.0E-25
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 52 492 5.0E-25
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 99 497 7.0E-25
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 53 492 8.0E-25
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 27 492 8.0E-25
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 50 492 2.0E-24
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 36 498 3.0E-24
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 27 492 3.0E-24
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 14 492 3.0E-24
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 27 492 4.0E-24
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 91 497 6.0E-24
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 85 537 9.0E-24
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 82 496 1.0E-23
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 59 507 2.0E-23
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 14 490 2.0E-23
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 91 497 2.0E-23
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 81 492 5.0E-23
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 110 513 1.0E-22
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 91 497 2.0E-22
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 79 493 3.0E-22
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 10 507 3.0E-22
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 116 497 4.0E-22
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 110 492 1.0E-21
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 110 492 1.0E-21
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 47 497 1.0E-21
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 116 497 2.0E-21
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 137 500 2.0E-21
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 54 492 2.0E-21
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 52 498 2.0E-21
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 82 496 3.0E-21
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 48 387 3.0E-21
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 51 387 4.0E-21
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 135 493 5.0E-21
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 115 491 7.0E-21
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 137 491 1.0E-20
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 115 491 1.0E-20
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 53 272 1.0E-20
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 47 497 1.0E-20
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 92 494 2.0E-20
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 110 513 2.0E-20
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 91 497 2.0E-20
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 137 491 3.0E-20
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 137 491 3.0E-20
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 135 493 3.0E-20
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 55 492 4.0E-20
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 17 495 6.0E-20
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 115 510 6.0E-20
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 115 510 7.0E-20
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 54 259 8.0E-20
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 53 491 9.0E-20
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 48 534 1.0E-19
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 110 498 1.0E-19
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 91 496 1.0E-19
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 115 493 2.0E-19
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 51 236 2.0E-19
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 90 499 3.0E-19
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 115 493 3.0E-19
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 91 497 4.0E-19
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 115 510 4.0E-19
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 101 500 7.0E-19
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 115 493 9.0E-19
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 48 492 1.0E-18
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 115 493 2.0E-18
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 91 497 3.0E-18
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 137 493 4.0E-18
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 115 493 4.0E-18
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 115 491 4.0E-18
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 55 499 5.0E-18
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 137 491 7.0E-18
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 48 498 7.0E-18
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 115 493 1.0E-17
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 101 500 2.0E-17
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 137 497 2.0E-17
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 91 497 2.0E-17
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 101 500 8.0E-17
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 113 496 2.0E-16
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 116 493 2.0E-16
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 91 497 3.0E-16
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 79 498 3.0E-16
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 42 493 3.0E-16
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 82 359 3.0E-16
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 101 500 6.0E-16
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 91 491 1.0E-15
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 61 250 1.0E-15
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 113 378 4.0E-15
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 53 398 3.0E-14
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 148 493 8.0E-14
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 92 499 8.0E-12
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 46 490 1.0E-11
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 89 538 1.0E-11
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 85 331 3.0E-11
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 49 490 1.0E-10
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 49 490 2.0E-10
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 49 490 2.0E-10
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 85 430 2.0E-10
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 116 493 4.0E-10
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 49 490 5.0E-10
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 53 488 7.0E-10
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 90 505 1.0E-09
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 85 490 3.0E-09
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 49 490 3.0E-09
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 282 496 5.0E-09
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 261 496 6.0E-09
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 90 501 1.0E-08
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 137 500 5.0E-08
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 412 512 8.0E-08
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 46 246 1.0E-07
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 46 246 1.0E-07
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 46 246 2.0E-07
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 53 359 2.0E-07
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 49 490 3.0E-07
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 396 497 7.0E-07
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 396 497 7.0E-07
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 289 491 7.0E-07
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 79 359 8.0E-07
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 142 240 8.0E-07
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 70 517 9.0E-07
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 91 506 1.0E-06
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 69 436 1.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 87 490 1.0E-06
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 396 495 2.0E-06
sp|P13865|PRO1_LEIEN Probable transport protein OS=Leishmania enriettii GN=PRO-1 PE=2 SV=1 84 480 3.0E-06
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 91 506 4.0E-06
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 99 493 5.0E-06
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 100 516 6.0E-06
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 42 202 7.0E-06
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 42 202 7.0E-06
sp|B7MBY6|NANT_ECO45 Putative sialic acid transporter OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B6I1U2|NANT_ECOSE Putative sialic acid transporter OS=Escherichia coli (strain SE11) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B7NKT5|NANT_ECO7I Putative sialic acid transporter OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B7UJV7|NANT_ECO27 Putative sialic acid transporter OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|A7ZSB7|NANT_ECO24 Putative sialic acid transporter OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 81 490 8.0E-06
sp|P59699|NANT_SHIFL Putative sialic acid transporter OS=Shigella flexneri GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|Q0T066|NANT_SHIF8 Putative sialic acid transporter OS=Shigella flexneri serotype 5b (strain 8401) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B2U1W0|NANT_SHIB3 Putative sialic acid transporter OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B1IQQ5|NANT_ECOLC Putative sialic acid transporter OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B7M0T6|NANT_ECO8A Putative sialic acid transporter OS=Escherichia coli O8 (strain IAI1) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|B7LHS8|NANT_ECO55 Putative sialic acid transporter OS=Escherichia coli (strain 55989 / EAEC) GN=nanT PE=3 SV=1 42 202 8.0E-06
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 87 523 9.0E-06
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|B5YSV1|NANT_ECO5E Putative sialic acid transporter OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|Q8X9G8|NANT_ECO57 Putative sialic acid transporter OS=Escherichia coli O157:H7 GN=nanT PE=3 SV=2 42 202 9.0E-06
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|P41036|NANT_ECOLI Putative sialic acid transporter OS=Escherichia coli (strain K12) GN=nanT PE=1 SV=2 42 202 9.0E-06
sp|B1XHJ7|NANT_ECODH Putative sialic acid transporter OS=Escherichia coli (strain K12 / DH10B) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|C4ZSW2|NANT_ECOBW Putative sialic acid transporter OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 42 202 9.0E-06
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 42 202 1.0E-05
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 42 202 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 92 109 17
3 114 133 19
4 138 160 22
5 173 195 22
6 200 222 22
7 294 316 22
8 331 353 22
9 360 382 22
10 395 417 22
11 424 446 22
12 456 478 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4938
MAPKLDLETVEIAHANDVNALISEMDRQLEAAGGLQEGFFHPRFRHPRHFTWLLVAFASMGGLLSGLDQSLISGA
NLYLPADLGLSDRENSLVNSGMPLGAVGGALLLSPANEYFGRKGAIIISIVLILSNAVDEAMMVAARVILGLGVG
LEGGTVPVYVAETVERSIRGNLVSLYQFNIALGEVLGYAVAAMFLKVSGNWRFILGSSLLFSTVMFIGMLFLPES
PRYLMHKGRKLDSYKVWKRIRGIESSESRLEFFLMAATVQEDALVDQGEAKNRRFPWLDFFTVPRARRALVYANI
MVLLGQLTGINAIMYYMSVLMNQIGFDPERANYMSLVGGGSLLIGTIPAIFLMERFGRRFWAITMLPGFLVGLVL
IGVSYQIPLQTHTMAVEACYLTGLVIYMGFFGSYACLTWVIPSEVYPTYLRSYGMTTSDALLFFASFIVTYNFTA
MQKAMTRTGLTLGFYGGIALLGELYQILLMPETKNKTLEEIDAVLSRPTLEIARENWAGVKENVRNLLGGRFGEV
FLQREGRSGSMEKE*
Coding >Ophun1|4938
ATGGCCCCCAAACTCGACCTCGAAACCGTCGAAATCGCCCACGCCAACGATGTAAACGCACTCATCTCCGAAATG
GACCGCCAGCTGGAAGCCGCCGGCGGTCTGCAGGAAGGCTTCTTCCATCCTCGCTTCCGCCACCCTCGTCACTTC
ACCTGGCTGCTCGTCGCCTTTGCCAGCATGGGCGGTCTGCTCTCCGGGCTGGATCAGAGCCTCATCTCCGGCGCG
AACTTGTATCTCCCTGCTGACCTTGGGCTTTCGGACCGGGAGAATAGCCTTGTCAACTCGGGGATGCCGTTGGGG
GCGGTGGGGGGCGCGCTGCTGCTCTCGCCTGCGAATGAGTACTTTGGACGCAAGGGGGCCATCATCATCTCCATC
GTGCTTATACTGTCTAACGCTGTGGACGAAGCCATGATGGTTGCCGCCCGAGTCATCCTCGGTCTGGGCGTTGGT
CTTGAAGGCGGGACGGTGCCTGTCTATGTAGCCGAGACGGTTGAGCGCAGCATCCGAGGCAACCTGGTGTCTCTC
TACCAGTTCAACATTGCCCTGGGCGAGGTTCTAGGATACGCCGTGGCCGCCATGTTCCTCAAGGTATCAGGCAAC
TGGCGATTCATCCTCGGCTCGTCTCTGCTATTTTCGACCGTCATGTTTATCGGGATGCTTTTCCTGCCCGAGAGC
CCGAGATATCTCATGCACAAGGGCAGGAAACTCGACTCCTACAAGGTCTGGAAGCGGATCCGCGGCATCGAATCG
AGCGAGTCGCGTCTTGAGTTCTTTCTCATGGCTGCTACCGTTCAGGAAGATGCCTTGGTAGATCAGGGTGAGGCC
AAGAACCGACGCTTCCCATGGCTCGACTTTTTCACCGTCCCTCGAGCTCGCAGAGCCCTCGTCTACGCCAACATC
ATGGTCCTCCTTGGCCAGCTAACCGGCATCAACGCCATCATGTACTACATGTCCGTCCTGATGAACCAGATCGGC
TTCGACCCCGAGCGGGCAAACTACATGTCCCTCGTCGGCGGCGGATCTCTCCTCATCGGCACCATCCCGGCCATC
TTCTTGATGGAGAGATTTGGCCGCCGCTTCTGGGCCATCACGATGCTTCCCGGCTTCCTGGTTGGCCTTGTTCTC
ATCGGCGTCTCGTATCAGATTCCGCTGCAGACGCATACCATGGCCGTCGAAGCCTGCTATCTTACGGGGCTGGTC
ATCTACATGGGTTTTTTCGGCTCGTACGCCTGTCTGACATGGGTGATTCCGTCCGAGGTGTATCCAACTTACCTC
CGCAGCTACGGCATGACCACCTCGGACGCCCTCCTCTTCTTCGCCTCCTTCATCGTAACCTACAACTTCACCGCC
ATGCAAAAAGCCATGACACGAACAGGTCTAACACTGGGATTCTACGGCGGCATCGCCCTCCTCGGCGAGCTGTAC
CAGATCCTACTCATGCCCGAGACGAAGAACAAGACGCTCGAGGAGATTGACGCCGTGCTGTCGAGGCCGACGCTC
GAGATTGCTCGCGAGAACTGGGCGGGGGTCAAGGAGAATGTGAGGAATCTACTTGGTGGTCGGTTTGGTGAGGTG
TTTTTACAGCGGGAGGGGAGGTCTGGGTCGATGGAGAAGGAGTAG
Transcript >Ophun1|4938
ATGGCCCCCAAACTCGACCTCGAAACCGTCGAAATCGCCCACGCCAACGATGTAAACGCACTCATCTCCGAAATG
GACCGCCAGCTGGAAGCCGCCGGCGGTCTGCAGGAAGGCTTCTTCCATCCTCGCTTCCGCCACCCTCGTCACTTC
ACCTGGCTGCTCGTCGCCTTTGCCAGCATGGGCGGTCTGCTCTCCGGGCTGGATCAGAGCCTCATCTCCGGCGCG
AACTTGTATCTCCCTGCTGACCTTGGGCTTTCGGACCGGGAGAATAGCCTTGTCAACTCGGGGATGCCGTTGGGG
GCGGTGGGGGGCGCGCTGCTGCTCTCGCCTGCGAATGAGTACTTTGGACGCAAGGGGGCCATCATCATCTCCATC
GTGCTTATACTGTCTAACGCTGTGGACGAAGCCATGATGGTTGCCGCCCGAGTCATCCTCGGTCTGGGCGTTGGT
CTTGAAGGCGGGACGGTGCCTGTCTATGTAGCCGAGACGGTTGAGCGCAGCATCCGAGGCAACCTGGTGTCTCTC
TACCAGTTCAACATTGCCCTGGGCGAGGTTCTAGGATACGCCGTGGCCGCCATGTTCCTCAAGGTATCAGGCAAC
TGGCGATTCATCCTCGGCTCGTCTCTGCTATTTTCGACCGTCATGTTTATCGGGATGCTTTTCCTGCCCGAGAGC
CCGAGATATCTCATGCACAAGGGCAGGAAACTCGACTCCTACAAGGTCTGGAAGCGGATCCGCGGCATCGAATCG
AGCGAGTCGCGTCTTGAGTTCTTTCTCATGGCTGCTACCGTTCAGGAAGATGCCTTGGTAGATCAGGGTGAGGCC
AAGAACCGACGCTTCCCATGGCTCGACTTTTTCACCGTCCCTCGAGCTCGCAGAGCCCTCGTCTACGCCAACATC
ATGGTCCTCCTTGGCCAGCTAACCGGCATCAACGCCATCATGTACTACATGTCCGTCCTGATGAACCAGATCGGC
TTCGACCCCGAGCGGGCAAACTACATGTCCCTCGTCGGCGGCGGATCTCTCCTCATCGGCACCATCCCGGCCATC
TTCTTGATGGAGAGATTTGGCCGCCGCTTCTGGGCCATCACGATGCTTCCCGGCTTCCTGGTTGGCCTTGTTCTC
ATCGGCGTCTCGTATCAGATTCCGCTGCAGACGCATACCATGGCCGTCGAAGCCTGCTATCTTACGGGGCTGGTC
ATCTACATGGGTTTTTTCGGCTCGTACGCCTGTCTGACATGGGTGATTCCGTCCGAGGTGTATCCAACTTACCTC
CGCAGCTACGGCATGACCACCTCGGACGCCCTCCTCTTCTTCGCCTCCTTCATCGTAACCTACAACTTCACCGCC
ATGCAAAAAGCCATGACACGAACAGGTCTAACACTGGGATTCTACGGCGGCATCGCCCTCCTCGGCGAGCTGTAC
CAGATCCTACTCATGCCCGAGACGAAGAACAAGACGCTCGAGGAGATTGACGCCGTGCTGTCGAGGCCGACGCTC
GAGATTGCTCGCGAGAACTGGGCGGGGGTCAAGGAGAATGTGAGGAATCTACTTGGTGGTCGGTTTGGTGAGGTG
TTTTTACAGCGGGAGGGGAGGTCTGGGTCGATGGAGAAGGAGTAG
Gene >Ophun1|4938
ATGGCCCCCAAACTCGACCTCGAAACCGTCGAAATCGCCCACGCCAACGATGTAAACGCACTCATCTCCGAAATG
GACCGCCAGCTGGAAGCCGCCGGCGGTCTGCAGGAAGGCTTCTTCCATCCTCGCTTCCGCCACCCTCGTCACTTC
ACCTGGCTGCTCGTCGCCTTTGCCAGCATGGGCGGTCTGCTCTCCGGGCTGGATCAGAGCCTCATCTCCGGCGCG
AACTTGTATCTCCCTGCTGACCTTGGGCTTTCGGACCGGGAGAATAGCCTTGTCAACTCGGGGATGCCGTTGGGG
GCGGTGGGGGGCGCGCTGCTGCTCTCGCCTGCGAATGAGTACTTTGGACGCAAGGGGGCCATCATCATCTCCATC
GTGCTGTATACCATTGGGGCTGCTCTTGAGGCGGGCTCCCTCAACTTTGGCGAGTTGTTTCCCCCCCTTAGGCTT
ATAGTATACTGTCTAACGCTGTGGACGAAGCCATGATGGTTGCCGCCCGAGTCATCCTCGGTCTGGGCGTTGGTC
TTGAAGGCGGGACGGTGCCTGTCTATGTAGCCGAGACGGTTGAGCGCAGCATCCGAGGCAACCTGGTGTCTCTCT
ACCAGTTCAACATTGCCCTGGGCGAGGTTCTAGGATACGCCGTGGCCGCCATGTTCCTCAAGGTATCAGGCAACT
GGCGATTCATCCTCGGCTCGTCTCTGCTATTTTCGACCGTCATGTTTATCGGGTAAGATGGAGACATGTTCTCAT
TGACGATGCTCAGCTTGAGTTGACGTCTTGAAGGATGCTTTTCCTGCCCGAGAGCCCGAGATATCTCATGCACAA
GGGCAGGAAACTCGACTCCTACAAGGTCTGGAAGCGGATCCGCGGCATCGAATCGAGCGAGTCGCGTCTTGAGTT
CTTTCTCATGGCTGCTACCGTTCAGGAAGATGCCTTGGTAGATCAGGGTGAGGCCAAGAACCGACGCTTCCCATG
GCTCGACTTTTTCACGTACGTTGCTCTTCTATAACCCGTACTACCGATGAGACTAACATGTTTCCTCTACCGTAG
CGTCCCTCGAGCTCGCAGAGCCCTCGTCTACGCCAACATCATGGTCCTCCTTGGCCAGCTAACCGGCATCAACGC
CATCATGTACTACATGTCCGTCCTGATGAACCAGATCGGCTTCGACCCCGAGCGGGCAAACTACATGTCCCTCGT
CGGCGGCGGATCTCTCCTCATCGGCACCATCCCGGCCATCTTCTTGATGGAGAGATTTGGCCGCCGCTTCTGGGC
CATCACGATGCTTCCCGGCTTCCTGGTTGGCCTTGTTCTCATCGGCGTCTCGTATCAGATTCCGCTGCAGACGCA
TACCATGGCCGTCGAAGCCTGCTATCTTACGGGGCTGGTCATCTACATGGGTTTTTTCGGCTCGTACGCCTGTCT
GACATGGGGTGAGCTCTTGACTCTGAGTCTCGGGGGTAATGGAAGCTGATGCTCGCAGTGATTCCGTCCGAGGTG
TATCCAACTTACCTCCGCAGCTACGGCATGACCACCTCGGACGCCCTCCTCTTCTTCGCCTCCTTCATCGTAACC
TACAACTTCACCGCCATGCAAAAAGCCATGACACGAACAGGTCTAACACTGGGATTCTACGGCGGCATCGCCCTC
CTCGGCGAGCTGTACCAGATCCTACTCATGCCCGAGACGAAGAACAAGACGCTCGAGGAGATTGACGCCGTGCTG
TCGAGGCCGACGCTCGAGATTGCTCGCGAGAACTGGGCGGGGGTCAAGGAGAATGTGAGGAATCTACTTGGTGGT
CGGTTTGGTGAGGTGTTTTTACAGCGGGAGGGGAGGTCTGGGTCGATGGAGAAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail