Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4937
Gene name
LocationContig_47:14693..17870
Strand+
Gene length (bp)3177
Transcript length (bp)2574
Coding sequence length (bp)2574
Protein length (aa) 858

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.0E-32 57 425
PF01266 DAO FAD dependent oxidoreductase 1.3E-20 510 847

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 14 498 1.0E-61
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 13 470 2.0E-58
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 41 470 3.0E-57
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 40 498 1.0E-54
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 13 490 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 14 498 1.0E-61
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 13 470 2.0E-58
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 41 470 3.0E-57
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 40 498 1.0E-54
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 13 490 2.0E-54
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 37 498 1.0E-36
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 37 309 4.0E-36
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 40 309 4.0E-34
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 6 498 5.0E-33
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 37 425 4.0E-32
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 14 498 5.0E-29
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 509 851 2.0E-28
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 38 255 2.0E-27
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 42 248 5.0E-27
sp|P80324|OXDA_RHOTO D-amino-acid oxidase OS=Rhodosporidium toruloides GN=DAO1 PE=1 SV=1 510 848 1.0E-25
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 38 471 2.0E-25
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 3 499 1.0E-24
sp|P24552|OXDA_FUSSO D-amino-acid oxidase OS=Fusarium solani subsp. pisi PE=1 SV=1 507 848 2.0E-24
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 41 488 2.0E-24
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 8 498 3.0E-23
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 22 470 6.0E-22
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 32 366 5.0E-21
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 510 844 2.0E-20
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 41 490 3.0E-19
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 5 498 2.0E-17
sp|Q556W1|OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum GN=ddo-1 PE=3 SV=1 510 848 6.0E-17
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 41 298 2.0E-16
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 38 274 3.0E-16
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 42 492 2.0E-15
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 6 475 2.0E-13
sp|P31228|OXDD_BOVIN D-aspartate oxidase OS=Bos taurus GN=DDO PE=1 SV=2 505 848 2.0E-11
sp|Q95XG9|OXDA_CAEEL D-amino-acid oxidase OS=Caenorhabditis elegans GN=daao-1 PE=1 SV=2 508 853 3.0E-11
sp|Q922Z0|OXDD_MOUSE D-aspartate oxidase OS=Mus musculus GN=Ddo PE=1 SV=1 505 850 4.0E-11
sp|Q99489|OXDD_HUMAN D-aspartate oxidase OS=Homo sapiens GN=DDO PE=2 SV=1 505 848 7.0E-11
sp|A8XJ44|OXDA_CAEBR D-amino-acid oxidase OS=Caenorhabditis briggsae GN=daao-1 PE=3 SV=1 508 856 2.0E-10
sp|P00371|OXDA_PIG D-amino-acid oxidase OS=Sus scrofa GN=DAO PE=1 SV=2 510 848 9.0E-10
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 41 298 9.0E-10
sp|A2V9Y8|OXDA_MACFA D-amino-acid oxidase OS=Macaca fascicularis GN=DAO PE=2 SV=1 510 848 2.0E-09
sp|A3KCL7|OXDD_PIG D-aspartate oxidase OS=Sus scrofa GN=DDO PE=2 SV=1 505 848 2.0E-09
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 45 247 7.0E-08
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 125 255 8.0E-08
sp|P9WP27|DAO_MYCTU Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aao PE=1 SV=1 509 848 2.0E-07
sp|P9WP26|DAO_MYCTO Probable D-amino-acid oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aao PE=3 SV=1 509 848 2.0E-07
sp|P22942|OXDA_RABIT D-amino-acid oxidase OS=Oryctolagus cuniculus GN=DAO PE=2 SV=1 510 848 2.0E-07
sp|O35078|OXDA_RAT D-amino-acid oxidase OS=Rattus norvegicus GN=Dao PE=2 SV=1 510 848 1.0E-06
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 37 259 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016491 oxidoreductase activity Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0003824 catalytic activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 50 69 19
2 89 111 22
3 118 140 22
4 144 166 22
5 179 201 22
6 211 233 22
7 278 300 22
8 320 342 22
9 349 366 17
10 376 398 22
11 410 429 19
12 439 461 22
13 501 523 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4937
MAEAVETQAVKAASDQEKDAVQAVECAPIESHLLGYDSAVERRLRLKIDLCVVPTVSLLYLFCFIDRANLGNAKI
AGLDADLGMSGLDYNAVVSIFYISYILLEIPCSVLCKWMGPGWFLPLTAIMFGVVSVGTAFVTSIRQLMAVRFAL
GVFETGVMPGIAYYLSRWYRRAELAFRLSLYIVMAPIAGAFGGLLASAILSLDSFANLHSWRMIFAIEGIITITL
GALALFTLTDRPETARWLTDEEKRLAISRVKSERITATVVLDKIDKTKLLRGLSSPVTLLTSLIFLLNNVTVQGL
AFFAPTIVRGIYSDRSLIQQQLYTVPPYVVGAFFTLLFPFVSWRIDRRLIFIILSTPLVIVGYCMFLGSRDHTVR
YAATFLVASSAFALGPLTNAHVSVNVVSDTARSAAIGMNVMMGNIGGLISSWSFLPFDAPDYHIGNGLNLATAGT
VLVVATVMLLWQRRDNERRRACDSEAELAGLTQQEQQNLDWKHPDFRWKTYSFIMASPSVVIIGAGVIGLSCAVK
LQAKLAEQEVLRGHQIIVMAREWPSVPVPGVSTPSVDYASMWAGAHVRPIPAVTAQLRREAGWLKVTVAELERQL
EEEPGSGITRTEGIEYIDEPSVAYAGQTAAVFEQESGLGNYRLLQDDELPPDVVLGFSYQTFCINPQLYCQHLVR
KFLLGGGKAVKKDLGSEWEAFQPNVVLVIDASGVGFNDPKCFPIRGQTVLTTLPVTKTVTRQHGDGSKSFLVPRS
FCGGTVVGGTTEARDWREKADGPTRDRLLAGGEILARAQGCQGDMSVVADMVGRRPAREGGMRVGVEERSGKSVV
HAYGAGGRGFETSWGVACEVTQLAIPLLVAQT*
Coding >Ophun1|4937
ATGGCCGAAGCAGTCGAGACGCAGGCGGTCAAGGCCGCGAGCGACCAGGAGAAAGACGCCGTTCAGGCGGTCGAG
TGCGCCCCTATAGAAAGCCATTTGCTGGGATACGACTCGGCTGTTGAGCGCCGGCTGCGACTCAAGATCGATCTC
TGCGTCGTGCCCACCGTTTCATTACTCTATCTGTTCTGCTTCATCGACCGGGCGAACCTGGGCAACGCCAAGATT
GCCGGCCTGGACGCGGATCTGGGCATGAGCGGCCTCGACTACAATGCCGTCGTGTCCATCTTCTACATCTCGTAC
ATCCTGCTCGAGATTCCCTGCAGCGTGCTGTGCAAGTGGATGGGACCGGGCTGGTTCCTCCCGCTGACGGCCATC
ATGTTTGGCGTTGTCTCGGTGGGCACAGCGTTTGTGACTTCGATCCGGCAGCTGATGGCGGTGCGGTTCGCGCTG
GGCGTGTTTGAGACGGGCGTGATGCCGGGGATAGCCTACTATCTGTCTCGATGGTATCGTCGAGCCGAGTTGGCG
TTTCGTCTCTCTCTCTACATTGTCATGGCCCCCATCGCCGGTGCCTTTGGCGGCCTCCTCGCCTCCGCCATCCTC
TCCCTCGATAGCTTCGCCAACCTCCACAGCTGGCGCATGATCTTCGCCATAGAAGGCATCATCACCATAACCCTC
GGCGCCCTCGCCCTCTTCACCCTCACTGACCGGCCCGAGACAGCCCGCTGGCTGACAGACGAGGAGAAGCGGCTC
GCCATCTCGCGTGTCAAGTCGGAACGCATCACCGCAACCGTCGTCCTCGACAAGATTGACAAGACCAAGCTCCTC
CGTGGCCTCAGCTCTCCCGTCACCCTCCTCACCTCGCTCATCTTTCTGCTCAACAACGTCACCGTCCAGGGCCTG
GCCTTTTTCGCGCCCACCATTGTCAGGGGCATCTACAGTGACAGATCGTTGATCCAGCAGCAGCTTTATACGGTT
CCGCCGTATGTCGTCGGTGCCTTCTTCACCCTCCTCTTCCCCTTTGTGAGCTGGCGGATCGACCGACGGCTCATC
TTCATCATCCTCTCGACGCCCCTCGTCATCGTCGGCTACTGCATGTTCCTCGGCTCCAGAGATCATACGGTCCGG
TACGCAGCCACGTTCTTAGTCGCCTCGTCGGCTTTCGCGCTGGGCCCCCTGACCAACGCGCACGTGTCGGTCAAC
GTGGTGAGCGACACAGCCCGAAGCGCTGCCATTGGCATGAACGTCATGATGGGCAACATTGGCGGCCTCATCAGC
TCCTGGTCGTTTCTCCCCTTTGACGCGCCGGATTATCACATCGGCAACGGGCTGAATCTGGCGACGGCCGGCACC
GTCCTCGTCGTTGCCACGGTGATGCTGTTGTGGCAGAGGCGGGATAACGAGAGGAGACGGGCTTGCGACTCGGAG
GCTGAGCTGGCTGGTCTGACGCAGCAGGAGCAGCAGAATCTGGACTGGAAACATCCTGACTTTCGGTGGAAGACA
TACAGTTTCATCATGGCCTCTCCCTCGGTCGTCATCATCGGCGCCGGCGTCATCGGCCTATCCTGCGCCGTCAAA
CTTCAAGCCAAGCTCGCAGAGCAAGAGGTTCTCCGCGGCCACCAGATAATCGTCATGGCGCGCGAGTGGCCTTCA
GTCCCTGTCCCCGGCGTATCGACGCCATCGGTAGACTATGCCTCCATGTGGGCTGGCGCTCACGTCAGGCCCATA
CCCGCCGTCACGGCTCAGTTGAGGCGCGAGGCTGGCTGGCTCAAGGTGACGGTTGCCGAGCTGGAGCGTCAGCTG
GAAGAGGAGCCCGGGAGTGGCATCACGCGGACCGAGGGCATCGAGTATATCGACGAGCCGTCCGTTGCCTACGCA
GGGCAGACGGCGGCTGTCTTTGAGCAGGAGTCTGGTCTCGGGAACTACCGTCTTCTCCAGGATGATGAACTGCCG
CCAGACGTCGTTCTCGGCTTCAGCTACCAGACGTTCTGCATCAACCCGCAACTCTACTGCCAACATCTTGTCCGC
AAGTTTCTCCTCGGCGGAGGCAAGGCAGTGAAGAAGGATCTAGGCAGCGAGTGGGAAGCATTCCAGCCCAACGTC
GTACTGGTGATTGACGCGAGTGGCGTCGGCTTCAACGATCCGAAGTGCTTCCCAATCAGAGGCCAGACCGTGCTC
ACAACCCTCCCCGTAACCAAGACGGTAACCAGACAACACGGAGACGGAAGCAAGAGCTTCCTGGTGCCCCGGTCC
TTTTGCGGCGGGACCGTGGTAGGCGGCACCACCGAGGCCAGAGACTGGCGGGAGAAGGCCGACGGGCCGACGAGG
GACCGTCTGCTGGCTGGGGGCGAGATACTGGCTCGCGCACAGGGCTGTCAAGGGGACATGAGCGTCGTTGCGGAC
ATGGTCGGCCGGAGACCTGCTCGTGAAGGCGGCATGAGGGTCGGCGTCGAGGAGAGAAGCGGGAAGAGCGTGGTT
CATGCGTACGGGGCTGGTGGACGGGGCTTCGAGACGAGTTGGGGGGTTGCTTGCGAGGTTACGCAGCTGGCGATC
CCCCTGCTTGTGGCACAGACGTAG
Transcript >Ophun1|4937
ATGGCCGAAGCAGTCGAGACGCAGGCGGTCAAGGCCGCGAGCGACCAGGAGAAAGACGCCGTTCAGGCGGTCGAG
TGCGCCCCTATAGAAAGCCATTTGCTGGGATACGACTCGGCTGTTGAGCGCCGGCTGCGACTCAAGATCGATCTC
TGCGTCGTGCCCACCGTTTCATTACTCTATCTGTTCTGCTTCATCGACCGGGCGAACCTGGGCAACGCCAAGATT
GCCGGCCTGGACGCGGATCTGGGCATGAGCGGCCTCGACTACAATGCCGTCGTGTCCATCTTCTACATCTCGTAC
ATCCTGCTCGAGATTCCCTGCAGCGTGCTGTGCAAGTGGATGGGACCGGGCTGGTTCCTCCCGCTGACGGCCATC
ATGTTTGGCGTTGTCTCGGTGGGCACAGCGTTTGTGACTTCGATCCGGCAGCTGATGGCGGTGCGGTTCGCGCTG
GGCGTGTTTGAGACGGGCGTGATGCCGGGGATAGCCTACTATCTGTCTCGATGGTATCGTCGAGCCGAGTTGGCG
TTTCGTCTCTCTCTCTACATTGTCATGGCCCCCATCGCCGGTGCCTTTGGCGGCCTCCTCGCCTCCGCCATCCTC
TCCCTCGATAGCTTCGCCAACCTCCACAGCTGGCGCATGATCTTCGCCATAGAAGGCATCATCACCATAACCCTC
GGCGCCCTCGCCCTCTTCACCCTCACTGACCGGCCCGAGACAGCCCGCTGGCTGACAGACGAGGAGAAGCGGCTC
GCCATCTCGCGTGTCAAGTCGGAACGCATCACCGCAACCGTCGTCCTCGACAAGATTGACAAGACCAAGCTCCTC
CGTGGCCTCAGCTCTCCCGTCACCCTCCTCACCTCGCTCATCTTTCTGCTCAACAACGTCACCGTCCAGGGCCTG
GCCTTTTTCGCGCCCACCATTGTCAGGGGCATCTACAGTGACAGATCGTTGATCCAGCAGCAGCTTTATACGGTT
CCGCCGTATGTCGTCGGTGCCTTCTTCACCCTCCTCTTCCCCTTTGTGAGCTGGCGGATCGACCGACGGCTCATC
TTCATCATCCTCTCGACGCCCCTCGTCATCGTCGGCTACTGCATGTTCCTCGGCTCCAGAGATCATACGGTCCGG
TACGCAGCCACGTTCTTAGTCGCCTCGTCGGCTTTCGCGCTGGGCCCCCTGACCAACGCGCACGTGTCGGTCAAC
GTGGTGAGCGACACAGCCCGAAGCGCTGCCATTGGCATGAACGTCATGATGGGCAACATTGGCGGCCTCATCAGC
TCCTGGTCGTTTCTCCCCTTTGACGCGCCGGATTATCACATCGGCAACGGGCTGAATCTGGCGACGGCCGGCACC
GTCCTCGTCGTTGCCACGGTGATGCTGTTGTGGCAGAGGCGGGATAACGAGAGGAGACGGGCTTGCGACTCGGAG
GCTGAGCTGGCTGGTCTGACGCAGCAGGAGCAGCAGAATCTGGACTGGAAACATCCTGACTTTCGGTGGAAGACA
TACAGTTTCATCATGGCCTCTCCCTCGGTCGTCATCATCGGCGCCGGCGTCATCGGCCTATCCTGCGCCGTCAAA
CTTCAAGCCAAGCTCGCAGAGCAAGAGGTTCTCCGCGGCCACCAGATAATCGTCATGGCGCGCGAGTGGCCTTCA
GTCCCTGTCCCCGGCGTATCGACGCCATCGGTAGACTATGCCTCCATGTGGGCTGGCGCTCACGTCAGGCCCATA
CCCGCCGTCACGGCTCAGTTGAGGCGCGAGGCTGGCTGGCTCAAGGTGACGGTTGCCGAGCTGGAGCGTCAGCTG
GAAGAGGAGCCCGGGAGTGGCATCACGCGGACCGAGGGCATCGAGTATATCGACGAGCCGTCCGTTGCCTACGCA
GGGCAGACGGCGGCTGTCTTTGAGCAGGAGTCTGGTCTCGGGAACTACCGTCTTCTCCAGGATGATGAACTGCCG
CCAGACGTCGTTCTCGGCTTCAGCTACCAGACGTTCTGCATCAACCCGCAACTCTACTGCCAACATCTTGTCCGC
AAGTTTCTCCTCGGCGGAGGCAAGGCAGTGAAGAAGGATCTAGGCAGCGAGTGGGAAGCATTCCAGCCCAACGTC
GTACTGGTGATTGACGCGAGTGGCGTCGGCTTCAACGATCCGAAGTGCTTCCCAATCAGAGGCCAGACCGTGCTC
ACAACCCTCCCCGTAACCAAGACGGTAACCAGACAACACGGAGACGGAAGCAAGAGCTTCCTGGTGCCCCGGTCC
TTTTGCGGCGGGACCGTGGTAGGCGGCACCACCGAGGCCAGAGACTGGCGGGAGAAGGCCGACGGGCCGACGAGG
GACCGTCTGCTGGCTGGGGGCGAGATACTGGCTCGCGCACAGGGCTGTCAAGGGGACATGAGCGTCGTTGCGGAC
ATGGTCGGCCGGAGACCTGCTCGTGAAGGCGGCATGAGGGTCGGCGTCGAGGAGAGAAGCGGGAAGAGCGTGGTT
CATGCGTACGGGGCTGGTGGACGGGGCTTCGAGACGAGTTGGGGGGTTGCTTGCGAGGTTACGCAGCTGGCGATC
CCCCTGCTTGTGGCACAGACGTAG
Gene >Ophun1|4937
ATGGCCGAAGCAGTCGAGACGCAGGCGGTCAAGGCCGCGAGCGACCAGGAGAAAGACGCCGTTCAGGCGGTCGAG
TGCGCCCCTATAGAGTCAGGATCATCTTGTGGAAACTCGTTTGGTGTGGGGGGGGGGGTGAAGCTGACGGTTTGG
GGGGGATGGGATAGAAGCCATTTGCTGGGATACGACTCGGCTGTTGAGCGCCGGCTGCGACTCAAGATCGATCTC
TGCGTCGTGCCCACCGTTTCATTACTCTATCTGTTCTGCTTCATCGACCGGGCGAACCTGGGTAAGTGAGAGGCC
CCAGACTGAGACGAAGCTTCAAGACTGAATATCCGCAAGGCAACGCCAAGATTGCCGGCCTGGACGCGGATCTGG
GCATGAGCGGCCTCGACTACAATGCCGTCGTGTCCATCTTCTACATCTCGTACATCCTGCTCGAGATTCCCTGCA
GCGTGCTGTGCAAGTGGATGGGACCGGGCTGGTTCCTCCCGCTGACGGCCATCATGTTTGGCGTTGTCTCGGTGG
GCACAGCGTTTGTGACTTCGATCCGGCAGCTGATGGCGGTGCGGTTCGCGCTGGGCGTGTTTGAGACGGGCGTGA
TGCCGGGGATAGCCTACTATCTGTCTCGATGGTATCGTCGAGCCGAGTTGGCGTTTCGTCTCTCTCTCTACATTG
TCATGGTGGGTAGAAACACTATCACGTCCACACATGGTGAAGGCTGTATTGCTGTTAACATGACAAGGCCCCCAT
CGCCGGTGCCTTTGGCGGCCTCCTCGCCTCCGCCATCCTCTCCCTCGATAGCTTCGCCAACCTCCACAGCTGGCG
CATGATCTTCGCCATAGAAGGCATCATCACCATAACCCTCGGCGCCCTCGCCCTCTTCACCCTCACTGACCGGCC
CGAGACAGCCCGCTGGCTGACAGACGAGGAGAAGCGGCTCGCCATCTCGCGTGTCAAGTCGGAACGCATCACCGC
AACCGTCGTCCTCGACAAGATTGACAAGACCAAGCTCCTCCGTGGCCTCAGCTCTCCCGTCACCCTCCTCACCTC
GCTCATCTTTCTGCTCAACAACGTCACCGTCCAGGGCCTGGCCTTTTTCGCGCCCACCATTGTCAGGGGCATCTA
CAGTGACAGATCGTTGATCCAGCAGCAGCTTTATACGGTTCCGCCGTATGTCGTCGGTGCCTTCTTCACCCTCCT
CTTCCCCTTTGTGAGCTGGCGGATCGACCGACGGCTCATCTTCATCATCCTCTCGACGCCCCTCGTCATCGTCGG
CTACTGCATGTTCCTCGGCTCCAGAGATCATACGGTCCGGTACGCAGCCACGTTCTTAGTCGCCTCGTCGGCTTT
CGCGCTGGGCCCCCTGACCAACGCGCACGTGTCGGTCAACGTGGTGAGCGACACAGCCCGAAGCGCTGCCATTGG
CATGAACGTCATGATGGGCAACATTGGCGGCCTCATCAGCTCCTGGTCGTTTCTCCCCTTTGACGCGCCGGATTA
TCACATCGGCAACGGGCTGAATCTGGCGACGGCCGGCACCGTCCTCGTCGTTGCCACGGTGATGCTGTTGTGGCA
GAGGCGGGATAACGAGAGGAGACGGGCTTGCGACTCGGAGGCTGAGCTGGCTGGTCTGACGCAGCAGGAGCAGCA
GAATCTGGACTGGAAACATCCTGACTTTCGGTGGAAGACGTGAGGTTACACGTTTGTATATACATGATGTATACG
AATACATGTATATATATATCTGTATCAGGTATGAGGGAAAACGAAGCTTGTTCCGAAGACTGCATGCTTCTCGTC
ATCTATCAGATATCATCACGATTACTTCGTACGAATAGAGGACAACGGCTGACGCCACAGTCGTCATCTCTGCAA
CCGCCGGACCTGCCCCGGGTCGGAGCTCCGAGTGGGGTCCCGAGCTCGGTCCCGAACCGTCCCTGCCAACAAGAT
AGGCCAGCAACCCCTTTGACCCCCTCTTCGATCCTCACCATCTCCCAGATACAGTTTCATCATGGCCTCTCCCTC
GGTCGTCATCATCGGGTGAGTAGATGCGCAGCAAGTGTGCAAAGCAAGCAGCCAATGACAGTCCCAGCGCCGGCG
TCATCGGCCTATCCTGCGCCGTCAAACTTCAAGCCAAGCTCGCAGAGCAAGAGGTTCTCCGCGGCCACCAGATAA
TCGTCATGGCGCGCGAGTGGCCTTCAGTCCCTGTCCCCGGCGTATCGACGCCATCGGTAGACTATGCCTCCATGT
GGGCTGGCGCTCACGTCAGGCCCATACCCGCCGTCACGGCTCAGTTGAGGCGCGAGGCTGGCTGGCTCAAGGTGA
CGGTTGCCGAGCTGGAGCGTCAGCTGGAAGAGGAGCCCGGGAGTGGCATCACGCGGACCGAGGGCATCGAGTATA
TCGACGAGCCGTCCGTTGCCTACGCAGGGCAGACGGCGGCTGTCTTTGAGCAGGAGTCTGGTCTCGGGAACTACC
GTCTTCTCCAGGATGATGAACTGCCGCCAGACGTCGTTCTCGGCTTCAGCTACCAGACGTTCTGCATCAACCCGC
AACTCTACTGCCAACATCTTGTCCGCAAGTTTCTCCTCGGCGGAGGCAAGGCAGTGAAGAAGGATCTAGGCAGCG
AGTGGGAAGCATTCCAGCCCAACGTCGTACTGGTGATTGACGCGAGTGGCGTCGGCTTCAACGATCCGAAGTGCT
TCCCAATCAGAGGTTTAAACTCCTCGTGCAACTCCTTGGCAGCTTGGCTGACCACATAGCAAAGGCCAGACCGTG
CTCACAACCCTCCCCGTAACCAAGACGGTAACCAGACAACACGGAGACGGAAGCAAGAGCTTCCTGGTGCCCCGG
TCCTTTTGCGGCGGGACCGTGGTAGGCGGCACCACCGAGGCCAGAGACTGGCGGGAGAAGGCCGACGGGCCGACG
AGGGACCGTCTGCTGGCTGGGGGCGAGATACTGGCTCGCGCACAGGGCTGTCAAGGGGACATGAGCGTCGTTGCG
GACATGGTCGGCCGGAGACCTGCTCGTGAAGGCGGCATGAGGGTCGGCGTCGAGGAGAGAAGCGGGAAGAGCGTG
GTTCATGCGTACGGGGCTGGTGGACGGGGCTTCGAGACGAGTTGGGGGGTTGCTTGCGAGGTTACGCAGCTGGCG
ATCCCCCTGCTTGTGGCACAGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail