Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4934
Gene name
LocationContig_47:8368..9387
Strand+
Gene length (bp)1019
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 79 300 1.0E-59
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 89 298 2.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 79 298 7.0E-41
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 19 298 5.0E-39
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 19 298 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 79 300 1.0E-59
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 89 298 2.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 79 298 7.0E-41
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 19 298 5.0E-39
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 19 298 5.0E-38
sp|Q5R6W5|YIPF5_PONAB Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1 87 298 6.0E-38
sp|Q969M3|YIPF5_HUMAN Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1 87 298 6.0E-38
sp|Q4R5M4|YIPF5_MACFA Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2 SV=1 87 298 8.0E-38
sp|Q66KA5|YIPF5_XENTR Protein YIPF5 OS=Xenopus tropicalis GN=yipf5 PE=2 SV=1 92 298 2.0E-37
sp|Q5E9E8|YIPF5_BOVIN Protein YIPF5 OS=Bos taurus GN=YIPF5 PE=2 SV=1 87 298 2.0E-37
sp|Q9JIM5|YIPF7_MOUSE Protein YIPF7 OS=Mus musculus GN=Yipf7 PE=2 SV=1 19 298 5.0E-36
sp|Q8N8F6|YIPF7_HUMAN Protein YIPF7 OS=Homo sapiens GN=YIPF7 PE=2 SV=2 89 298 9.0E-36
sp|Q9EQQ2|YIPF5_MOUSE Protein YIPF5 OS=Mus musculus GN=Yipf5 PE=1 SV=1 102 298 3.0E-31
sp|Q5XID0|YIPF5_RAT Protein YIPF5 OS=Rattus norvegicus GN=Yipf5 PE=2 SV=1 102 298 4.0E-31
sp|A5D7K7|YIPF7_BOVIN Protein YIPF7 OS=Bos taurus GN=YIPF7 PE=2 SV=1 103 298 1.0E-29
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 133 150 17
2 155 177 22
3 218 240 22
4 250 272 22
5 279 298 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4934
MSNLYGSANPPYGTAAAQNLQFYPSSYAPTGPASHQGQPTYGYGAGSSAAAVNAPGGGAPSASGPGFGVSGRMGE
QAGLRTGWLAAFSTEGYEGEPPLWEELGVNFGHIQKKTLAVLNPFRHIDQHLMDDNDLAGSILFFILFGFFLLFS
GKVHFGYIYGLALLGSTSLHFILSLMSPAEPQHASPSSSSAYHPQYSSDPSSQADLQQGGHFSSTLTFARSASVL
GYCLLPLVATSLLGVGMPMDTPLGIVLTSAAIVWSTYSASGMFCAVGRMKGMRGLVAYPLALFYVGFGIIGIFSS
RGSGSLANAAAKLNS*
Coding >Ophun1|4934
ATGTCAAACCTCTACGGAAGCGCCAACCCCCCCTACGGCACCGCCGCCGCCCAAAACCTCCAATTCTACCCATCG
TCATACGCGCCCACCGGCCCAGCCTCGCACCAGGGACAACCGACGTACGGGTACGGAGCGGGCTCCTCCGCCGCG
GCCGTCAACGCGCCGGGCGGCGGGGCCCCCTCTGCCTCTGGCCCCGGCTTCGGCGTTTCGGGGAGGATGGGCGAG
CAGGCTGGGCTGAGGACTGGATGGTTGGCGGCTTTTTCTACCGAGGGGTATGAGGGGGAGCCTCCGCTGTGGGAG
GAGCTTGGCGTCAACTTTGGACATATTCAGAAAAAGACACTAGCCGTCCTCAACCCCTTCCGCCACATCGACCAA
CACCTCATGGATGACAACGACCTCGCCGGCTCCATCCTCTTCTTCATCCTCTTCGGCTTCTTCCTCCTCTTCTCA
GGAAAGGTCCACTTCGGCTACATCTACGGCCTCGCCCTCCTAGGCTCTACATCGCTGCACTTCATCCTCTCCCTC
ATGTCCCCCGCCGAACCGCAGCACGCCTCCCCCTCGTCCTCATCCGCCTACCACCCGCAGTACAGCAGCGACCCT
TCGTCTCAGGCGGACTTGCAACAAGGTGGCCACTTCTCCTCCACGCTCACCTTCGCCCGCTCCGCCTCCGTTCTC
GGCTACTGCCTTCTCCCCCTCGTGGCTACCAGCCTCCTGGGCGTCGGCATGCCCATGGACACGCCCCTCGGCATC
GTCCTCACCAGCGCCGCCATCGTTTGGTCCACCTACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAG
GGCATGCGCGGCCTCGTCGCCTACCCCCTCGCCCTCTTCTACGTCGGCTTCGGCATCATCGGCATATTCAGCAGC
CGCGGCAGTGGATCCCTCGCAAACGCCGCCGCCAAGCTGAATAGTTGA
Transcript >Ophun1|4934
ATGTCAAACCTCTACGGAAGCGCCAACCCCCCCTACGGCACCGCCGCCGCCCAAAACCTCCAATTCTACCCATCG
TCATACGCGCCCACCGGCCCAGCCTCGCACCAGGGACAACCGACGTACGGGTACGGAGCGGGCTCCTCCGCCGCG
GCCGTCAACGCGCCGGGCGGCGGGGCCCCCTCTGCCTCTGGCCCCGGCTTCGGCGTTTCGGGGAGGATGGGCGAG
CAGGCTGGGCTGAGGACTGGATGGTTGGCGGCTTTTTCTACCGAGGGGTATGAGGGGGAGCCTCCGCTGTGGGAG
GAGCTTGGCGTCAACTTTGGACATATTCAGAAAAAGACACTAGCCGTCCTCAACCCCTTCCGCCACATCGACCAA
CACCTCATGGATGACAACGACCTCGCCGGCTCCATCCTCTTCTTCATCCTCTTCGGCTTCTTCCTCCTCTTCTCA
GGAAAGGTCCACTTCGGCTACATCTACGGCCTCGCCCTCCTAGGCTCTACATCGCTGCACTTCATCCTCTCCCTC
ATGTCCCCCGCCGAACCGCAGCACGCCTCCCCCTCGTCCTCATCCGCCTACCACCCGCAGTACAGCAGCGACCCT
TCGTCTCAGGCGGACTTGCAACAAGGTGGCCACTTCTCCTCCACGCTCACCTTCGCCCGCTCCGCCTCCGTTCTC
GGCTACTGCCTTCTCCCCCTCGTGGCTACCAGCCTCCTGGGCGTCGGCATGCCCATGGACACGCCCCTCGGCATC
GTCCTCACCAGCGCCGCCATCGTTTGGTCCACCTACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAG
GGCATGCGCGGCCTCGTCGCCTACCCCCTCGCCCTCTTCTACGTCGGCTTCGGCATCATCGGCATATTCAGCAGC
CGCGGCAGTGGATCCCTCGCAAACGCCGCCGCCAAGCTGAATAGTTGA
Gene >Ophun1|4934
ATGTCAAACCTCTACGGAAGCGCCAACCCCCCCTACGGCACCGCCGCCGCCCAAAACCTCCAATTCTACCCATCG
TCATACGCGCCCACCGGCCCAGCCTCGCACCAGGGACAACCGACGTACGGGTACGGAGCGGGCTCCTCCGCCGCG
GCCGTCAACGCGCCGGGCGGCGGGGCCCCCTCTGCCTCTGGCCCCGGCTTCGGCGTTTCGGGGAGGATGGGCGAG
CAGGCTGGGCTGAGGACTGGATGGTTGGCGGCTTTTTCTACCGAGGGGTATGAGGGGGAGCCTCCGCTGTGGGAG
GAGCTTGGCGTCAACTTTGGACATATTCAGAAAAAGGTGTGCCTTTTCCCCATCCTCTTTTTACGCCATCATCTT
CTCTTTCACCTTGCTAATAAGCTCCCCCCAAGACACTAGCCGTCCTCAACCCCTTCCGCCACATCGACCAACACC
TCATGGATGACAACGACCTCGCCGGCTCCATCCTCTTCTTCATCCTCTTCGGCTTCTTCCTCCTCTTCTCAGGAA
AGGTCCACTTCGGCTACATCTACGGCCTCGCCCTCCTAGGCTCTACATCGCTGCACTTCATCCTCTCCCTCATGT
CCCCCGCCGAACCGCAGCACGCCTCCCCCTCGTCCTCATCCGCCTACCACCCGCAGTACAGCAGCGACCCTTCGT
CTCAGGCGGACTTGCAACAAGGTGGCCACTTCTCCTCCACGCTCACCTTCGCCCGCTCCGCCTCCGTTCTCGGCT
ACTGCCTTCTCCCCCTCGTGGCTACCAGCCTCCTGGGCGTCGGCATGCCCATGGACACGCCCCTCGGCATCGTCC
TCACCAGCGCCGCCATCGTTTGGTCCACCTACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCAGGATGAAGGGCA
TGCGCGGCCTCGTCGCCTACCCCCTCGCCCTCTTCTACGTCGGCTTCGGCATCATCGGCATATTCAGCAGCCGCG
GCAGTGGATCCCTCGCAAACGCCGCCGCCAAGCTGAATAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail