Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4932
Gene name
LocationContig_469:13957..14514
Strand+
Gene length (bp)557
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 4.6E-24 12 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 6 136 7.0E-58
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 8 94 3.0E-31
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 11 131 3.0E-30
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 6 132 2.0E-28
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 3 136 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 6 136 7.0E-58
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 8 94 3.0E-31
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 11 131 3.0E-30
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 6 132 2.0E-28
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 3 136 1.0E-27
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 10 129 5.0E-27
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 10 82 1.0E-26
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 10 125 7.0E-25
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 13 136 1.0E-24
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 13 132 2.0E-24
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 13 133 2.0E-22
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 13 87 3.0E-22
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 10 82 4.0E-22
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 13 92 7.0E-22
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 10 82 8.0E-22
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 11 110 1.0E-21
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 11 129 2.0E-21
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 2 88 3.0E-21
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 11 88 6.0E-21
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 6 80 1.0E-20
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 10 82 2.0E-20
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 5 108 3.0E-20
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 11 88 4.0E-20
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 11 82 5.0E-20
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 10 130 7.0E-20
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 13 82 7.0E-20
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 6 82 1.0E-19
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 11 129 1.0E-19
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 10 90 2.0E-19
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 11 129 3.0E-19
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 7 82 2.0E-18
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 11 82 3.0E-18
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 14 82 5.0E-17
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 7 93 7.0E-14
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 1 93 9.0E-14
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 7 103 9.0E-14
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 7 82 2.0E-13
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 7 82 3.0E-13
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 1 82 4.0E-13
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 11 82 6.0E-13
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 1 128 6.0E-13
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 1 82 6.0E-13
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 3 128 1.0E-12
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 3 128 1.0E-12
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 7 82 2.0E-12
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 3 93 2.0E-12
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 4 92 2.0E-12
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 11 82 2.0E-12
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 6 61 3.0E-12
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 11 82 4.0E-12
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 7 82 6.0E-12
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 10 83 7.0E-12
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 7 82 1.0E-11
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 7 105 2.0E-11
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 10 111 2.0E-11
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 7 82 3.0E-11
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 2 82 3.0E-11
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 14 88 3.0E-11
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 7 82 4.0E-11
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 10 97 5.0E-11
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 14 82 5.0E-11
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 7 82 1.0E-10
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 7 82 2.0E-10
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 10 86 2.0E-10
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 10 77 2.0E-10
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 11 82 3.0E-10
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 11 88 5.0E-10
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 10 78 8.0E-10
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 1 89 1.0E-09
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 10 82 2.0E-09
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 10 80 2.0E-09
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 2 83 3.0E-09
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 11 62 3.0E-09
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 12 90 3.0E-09
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 10 89 3.0E-09
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 2 89 4.0E-09
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 11 90 4.0E-09
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 10 87 4.0E-09
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 2 89 5.0E-09
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 10 90 8.0E-09
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 10 80 8.0E-09
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 3 99 8.0E-09
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 8 85 9.0E-09
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 10 90 1.0E-08
sp|Q5MPP0|FA2H_MOUSE Fatty acid 2-hydroxylase OS=Mus musculus GN=Fa2h PE=1 SV=1 32 90 1.0E-08
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 10 61 1.0E-08
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 10 90 2.0E-08
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 10 90 2.0E-08
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 32 90 2.0E-08
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 14 80 3.0E-08
sp|A4IFP3|FADS3_BOVIN Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1 10 90 7.0E-08
sp|Q1ZXQ5|FAD5C_DICDI Probable Delta(5) fatty acid desaturase C OS=Dictyostelium discoideum GN=DDB_G0294553 PE=3 SV=1 11 134 8.0E-08
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 7 78 1.0E-07
sp|Q9Z122|FADS2_RAT Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1 12 90 1.0E-07
sp|Q9Z0R9|FADS2_MOUSE Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=1 SV=1 12 90 1.0E-07
sp|A8MWK0|FS2P1_HUMAN Putative fatty acid desaturase 2-like protein FADS2P1 OS=Homo sapiens GN=FADS2P1 PE=5 SV=2 11 90 1.0E-07
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 1 85 2.0E-07
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 10 90 2.0E-07
sp|Q920R3|FADS1_RAT Fatty acid desaturase 1 OS=Rattus norvegicus GN=Fads1 PE=2 SV=1 10 90 3.0E-07
sp|Q920L1|FADS1_MOUSE Fatty acid desaturase 1 OS=Mus musculus GN=Fads1 PE=1 SV=1 10 90 3.0E-07
sp|Q8K1P9|FADS3_RAT Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1 12 90 9.0E-07
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 14 94 1.0E-06
sp|Q9JJE7|FADS3_MOUSE Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2 12 90 1.0E-06
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 10 101 2.0E-06
sp|Q8S3C0|D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. GN=Fad4 PE=1 SV=1 8 82 3.0E-06
sp|Q6VPV2|D4FAD_DIALT Acyl-lipid (7-3)-desaturase OS=Diacronema lutheri GN=Plesd1 PE=1 SV=1 1 82 4.0E-06
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 10 82 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 111 133 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4932
MDSSAMSEGLTYQDVAEHNTKKDIYLVIHDKVYDCAQFIDEHPGGEEVMLDVAGQDATEAFEDVGHSDEARETLE
KLLVGKLKRQPGDPTPRIVSQSTYGSGSQSDSTGMGIGLYAILLFGSALGYIAYYYVAHRQEQSRAA*
Coding >Ophun1|4932
ATGGATTCCTCCGCCATGTCCGAAGGCCTCACCTACCAAGATGTCGCCGAGCACAATACCAAGAAGGATATTTAC
CTCGTCATCCACGACAAGGTCTACGACTGCGCGCAGTTCATCGACGAGCACCCCGGCGGCGAGGAGGTGATGCTC
GATGTCGCCGGCCAGGATGCCACCGAGGCCTTTGAGGATGTCGGCCACAGCGACGAGGCGAGGGAAACGCTCGAG
AAACTGTTGGTTGGCAAGCTGAAGCGTCAGCCTGGCGATCCGACGCCTCGAATCGTCTCTCAGTCGACGTATGGC
AGCGGAAGCCAGTCTGATTCCACGGGCATGGGCATCGGCCTCTACGCCATCCTCCTCTTCGGCAGCGCCCTCGGC
TACATTGCCTACTATTACGTGGCGCATCGACAGGAGCAATCCCGAGCTGCGTGA
Transcript >Ophun1|4932
ATGGATTCCTCCGCCATGTCCGAAGGCCTCACCTACCAAGATGTCGCCGAGCACAATACCAAGAAGGATATTTAC
CTCGTCATCCACGACAAGGTCTACGACTGCGCGCAGTTCATCGACGAGCACCCCGGCGGCGAGGAGGTGATGCTC
GATGTCGCCGGCCAGGATGCCACCGAGGCCTTTGAGGATGTCGGCCACAGCGACGAGGCGAGGGAAACGCTCGAG
AAACTGTTGGTTGGCAAGCTGAAGCGTCAGCCTGGCGATCCGACGCCTCGAATCGTCTCTCAGTCGACGTATGGC
AGCGGAAGCCAGTCTGATTCCACGGGCATGGGCATCGGCCTCTACGCCATCCTCCTCTTCGGCAGCGCCCTCGGC
TACATTGCCTACTATTACGTGGCGCATCGACAGGAGCAATCCCGAGCTGCGTGA
Gene >Ophun1|4932
ATGGATTCCTCCGCCATGTCCGAAGGCCTCACCTACCAAGATGTCGCCGAGCACAATACCAAGAAGGATATTTAC
CTCGTCATCCACGACAAGGTCTACGACTGCGCGCAGTTCATCGACGAGCACCCGTGCGTCTGCGCCGCTCCCCGC
CTCGACGACTCGCCATGCTGACATTTGTTTGCGCCCAGCGGCGGCGAGGAGGTGATGCTCGATGTCGCCGGCCAG
GATGCCACCGAGGCCTTTGAGGATGTCGGCCACAGCGACGAGGCGAGGGAAACGCTCGAGAAACTGTTGGTTGGC
AAGCTGAAGCGTCAGGTAATGTCTCGGCCGATCTGGACGGGGCGCATCCGATGGCTGACTTGTGTCCTCTTGTTT
CTCGACAGCCTGGCGATCCGACGCCTCGAATCGTCTCTCAGTCGACGTATGGCAGCGGAAGCCAGTCTGATTCCA
CGGGCATGGGCATCGGCCTCTACGCCATCCTCCTCTTCGGCAGCGCCCTCGGCTACATTGCCTACTATTACGTGG
CGCATCGACAGGAGCAATCCCGAGCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail