Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4923
Gene name
LocationContig_468:9552..11400
Strand+
Gene length (bp)1848
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04935 SURF6 Surfeit locus protein 6 2.8E-44 347 535
PF15459 RRP14 60S ribosome biogenesis protein Rrp14 4.0E-14 9 60

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36080|RRP14_YEAST Ribosomal RNA-processing protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP14 PE=1 SV=1 314 559 5.0E-16
sp|Q9VDS6|SURF6_DROME Surfeit locus protein 6 homolog OS=Drosophila melanogaster GN=Surf6 PE=1 SV=1 428 555 4.0E-13
sp|O43082|RR14C_SCHPO Ribosomal RNA-processing protein 14-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp14c PE=1 SV=1 318 524 2.0E-11
sp|P36080|RRP14_YEAST Ribosomal RNA-processing protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP14 PE=1 SV=1 4 60 8.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2438
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1162
Ophiocordyceps australis map64 (Brazil) OphauB2|2621
Ophiocordyceps camponoti-floridani Ophcf2|03211
Ophiocordyceps camponoti-rufipedis Ophun1|4923 (this protein)
Ophiocordyceps kimflemingae Ophio5|173
Ophiocordyceps subramaniannii Hirsu2|3469

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4923
MADSSLQDRLRNHAKAFDGLLSLIPAKTYYGQDASLEGNKRTKQSKQEAAAARRGKLDPDSELNRNAKEVMDERA
NNKRKLREMQQQGNEDEENDSDGEGHASDSFESIDGIEAEKPGEGMREKKASKKQRLQGGDENDESPNSTQRPQK
LSRKEEKRAAKRERKAGKKAEKKAKRKEEAVAAEDDVATAETHVPSTAAIKKTKKKKEKASNDDATPSEPQPLPS
PPTTLDCQATAEAPLSSQSNLSEPQDDDVKQKAPTSSESKAPTTASDAEESIPKPTDDASAEATGAPTSASSTTG
PASEKCKQIKMPADMTTLRARLAAKIEALRAARKADGPDGKPIRTRQELIEARRAKQAQRKAHKRELRMQAKQEE
ARKREEALASNSPGVGSPAGVDLDENLSFGRVVFGDGTQASHDLSYVLQKGKRKGPSDAKTALLKVQGQKKRLAE
LEPDKRADVADKEAWLTARRRVEGDKIRDDEATLKKAVRRKEAAKKKSKAAWRERSQGIEKAQKERQRKRETNIQ
KRRDDKMLGKAGKKKAAAGGKKGKAGRPGFEGSFGVGGRTK*
Coding >Ophun1|4923
ATGGCCGACTCGTCGTTGCAGGATCGCTTGAGAAATCATGCCAAGGCCTTTGATGGGCTCTTGAGCTTGATTCCG
GCCAAGACGTACTATGGGCAGGATGCCAGCTTGGAAGGAAATAAAAGAACGAAACAGAGCAAACAAGAGGCCGCA
GCCGCCCGTAGGGGCAAACTCGACCCGGACAGCGAACTGAACCGCAACGCCAAGGAGGTCATGGACGAGCGAGCC
AACAACAAGCGGAAGCTCCGGGAGATGCAGCAGCAAGGTAACGAGGACGAGGAGAACGATTCGGATGGCGAGGGT
CACGCAAGCGATTCTTTCGAGTCCATTGACGGCATTGAAGCCGAAAAACCAGGCGAGGGTATGAGGGAAAAAAAG
GCGTCCAAGAAACAGAGGCTGCAGGGTGGCGACGAGAATGACGAGTCTCCTAATTCCACCCAACGACCGCAGAAG
CTCTCCCGCAAGGAGGAGAAGAGGGCCGCCAAGAGGGAGAGAAAAGCGGGAAAGAAGGCGGAAAAAAAGGCCAAG
AGAAAAGAAGAAGCGGTGGCGGCAGAGGATGATGTTGCCACTGCTGAAACGCACGTCCCGTCGACGGCGGCGATC
AAAAAGACGAAGAAGAAGAAAGAAAAGGCCTCCAACGACGATGCCACGCCGTCTGAGCCGCAGCCGCTCCCCTCT
CCCCCGACCACGCTGGACTGCCAGGCAACGGCAGAAGCTCCGCTCTCGTCGCAGAGCAACCTGTCCGAGCCACAA
GACGATGACGTGAAGCAAAAGGCCCCGACTTCCTCCGAGTCAAAAGCCCCAACGACCGCATCCGACGCGGAAGAG
TCCATCCCGAAACCGACGGACGACGCCTCGGCTGAGGCCACAGGCGCTCCAACGTCAGCGTCGTCCACCACGGGT
CCCGCTTCGGAGAAATGCAAGCAGATCAAGATGCCGGCCGACATGACGACACTGCGGGCACGCCTGGCGGCCAAG
ATCGAAGCCCTTCGCGCAGCTAGGAAAGCTGATGGTCCAGACGGAAAGCCAATCCGCACACGACAGGAGCTCATC
GAGGCCCGACGCGCCAAGCAAGCACAACGCAAAGCGCACAAGCGAGAGCTCCGCATGCAGGCCAAGCAGGAAGAA
GCACGCAAACGGGAGGAGGCTCTGGCATCCAATTCACCCGGCGTAGGCAGCCCTGCAGGCGTCGACCTCGACGAG
AATCTTTCCTTTGGCCGCGTTGTCTTTGGCGACGGCACACAGGCATCTCACGACCTCAGCTACGTGCTCCAAAAG
GGCAAGCGCAAGGGCCCCTCGGACGCCAAGACGGCGCTGCTCAAGGTCCAAGGCCAGAAGAAGCGACTCGCCGAG
CTCGAGCCGGACAAGCGGGCCGACGTGGCGGATAAGGAGGCATGGCTCACGGCCCGGAGACGCGTCGAGGGCGAC
AAGATCCGCGACGACGAGGCCACACTGAAGAAGGCCGTTCGCCGCAAGGAGGCGGCCAAGAAGAAGAGCAAGGCT
GCCTGGCGCGAGCGCTCCCAGGGCATCGAGAAGGCGCAGAAGGAGCGGCAGAGGAAGCGCGAGACCAACATCCAG
AAGCGGCGCGACGACAAGATGCTCGGCAAGGCGGGCAAGAAAAAGGCCGCTGCTGGTGGGAAGAAGGGCAAGGCT
GGCCGTCCGGGGTTTGAGGGTAGCTTTGGCGTCGGTGGGCGGACCAAGTGA
Transcript >Ophun1|4923
ATGGCCGACTCGTCGTTGCAGGATCGCTTGAGAAATCATGCCAAGGCCTTTGATGGGCTCTTGAGCTTGATTCCG
GCCAAGACGTACTATGGGCAGGATGCCAGCTTGGAAGGAAATAAAAGAACGAAACAGAGCAAACAAGAGGCCGCA
GCCGCCCGTAGGGGCAAACTCGACCCGGACAGCGAACTGAACCGCAACGCCAAGGAGGTCATGGACGAGCGAGCC
AACAACAAGCGGAAGCTCCGGGAGATGCAGCAGCAAGGTAACGAGGACGAGGAGAACGATTCGGATGGCGAGGGT
CACGCAAGCGATTCTTTCGAGTCCATTGACGGCATTGAAGCCGAAAAACCAGGCGAGGGTATGAGGGAAAAAAAG
GCGTCCAAGAAACAGAGGCTGCAGGGTGGCGACGAGAATGACGAGTCTCCTAATTCCACCCAACGACCGCAGAAG
CTCTCCCGCAAGGAGGAGAAGAGGGCCGCCAAGAGGGAGAGAAAAGCGGGAAAGAAGGCGGAAAAAAAGGCCAAG
AGAAAAGAAGAAGCGGTGGCGGCAGAGGATGATGTTGCCACTGCTGAAACGCACGTCCCGTCGACGGCGGCGATC
AAAAAGACGAAGAAGAAGAAAGAAAAGGCCTCCAACGACGATGCCACGCCGTCTGAGCCGCAGCCGCTCCCCTCT
CCCCCGACCACGCTGGACTGCCAGGCAACGGCAGAAGCTCCGCTCTCGTCGCAGAGCAACCTGTCCGAGCCACAA
GACGATGACGTGAAGCAAAAGGCCCCGACTTCCTCCGAGTCAAAAGCCCCAACGACCGCATCCGACGCGGAAGAG
TCCATCCCGAAACCGACGGACGACGCCTCGGCTGAGGCCACAGGCGCTCCAACGTCAGCGTCGTCCACCACGGGT
CCCGCTTCGGAGAAATGCAAGCAGATCAAGATGCCGGCCGACATGACGACACTGCGGGCACGCCTGGCGGCCAAG
ATCGAAGCCCTTCGCGCAGCTAGGAAAGCTGATGGTCCAGACGGAAAGCCAATCCGCACACGACAGGAGCTCATC
GAGGCCCGACGCGCCAAGCAAGCACAACGCAAAGCGCACAAGCGAGAGCTCCGCATGCAGGCCAAGCAGGAAGAA
GCACGCAAACGGGAGGAGGCTCTGGCATCCAATTCACCCGGCGTAGGCAGCCCTGCAGGCGTCGACCTCGACGAG
AATCTTTCCTTTGGCCGCGTTGTCTTTGGCGACGGCACACAGGCATCTCACGACCTCAGCTACGTGCTCCAAAAG
GGCAAGCGCAAGGGCCCCTCGGACGCCAAGACGGCGCTGCTCAAGGTCCAAGGCCAGAAGAAGCGACTCGCCGAG
CTCGAGCCGGACAAGCGGGCCGACGTGGCGGATAAGGAGGCATGGCTCACGGCCCGGAGACGCGTCGAGGGCGAC
AAGATCCGCGACGACGAGGCCACACTGAAGAAGGCCGTTCGCCGCAAGGAGGCGGCCAAGAAGAAGAGCAAGGCT
GCCTGGCGCGAGCGCTCCCAGGGCATCGAGAAGGCGCAGAAGGAGCGGCAGAGGAAGCGCGAGACCAACATCCAG
AAGCGGCGCGACGACAAGATGCTCGGCAAGGCGGGCAAGAAAAAGGCCGCTGCTGGTGGGAAGAAGGGCAAGGCT
GGCCGTCCGGGGTTTGAGGGTAGCTTTGGCGTCGGTGGGCGGACCAAGTGA
Gene >Ophun1|4923
ATGGCCGACTCGTCGTTGCAGGTTCGTCGACCTTTGCTTGGCAGAGCGGCAATATGGCTGACGACTACAAGGATC
GCTTGAGAAATCATGCCAAGGCCTTTGATGGGCTCTTGAGCTTGATTCCGGCCAAGACGTACTATGGGCAGGATG
CCAGCGTATGCGACCCCTGCCTGAGAGACATGAGCGTCTCCTTCTTGGGACCCTGATCGGACTCCAAGTCCATTC
AAAGGGCCGCGACTGACGAAATCTTAGTTGGAAGGAAATAAAAGAACGAAACAGAGCAAACAAGAGGCCGCAGCC
GCCCGTAGGGGCAAACTCGACCCGGACAGCGAACTGAACCGCAACGCCAAGGAGGTCATGGACGAGCGAGCCAAC
AACAAGCGGAAGCTCCGGGAGATGCAGCAGCAAGGTAACGAGGACGAGGAGAACGATTCGGATGGCGAGGGTCAC
GCAAGCGATTCTTTCGAGTCCATTGACGGCATTGAAGCCGAAAAACCAGGCGAGGGTATGAGGGAAAAAAAGGCG
TCCAAGAAACAGAGGCTGCAGGGTGGCGACGAGAATGACGAGTCTCCTAATTCCACCCAACGACCGCAGAAGCTC
TCCCGCAAGGAGGAGAAGAGGGCCGCCAAGAGGGAGAGAAAAGCGGGAAAGAAGGCGGAAAAAAAGGCCAAGAGA
AAAGAAGAAGCGGTGGCGGCAGAGGATGATGTTGCCACTGCTGAAACGCACGTCCCGTCGACGGCGGCGATCAAA
AAGACGAAGAAGAAGAAAGAAAAGGCCTCCAACGACGATGCCACGCCGTCTGAGCCGCAGCCGCTCCCCTCTCCC
CCGACCACGCTGGACTGCCAGGCAACGGCAGAAGCTCCGCTCTCGTCGCAGAGCAACCTGTCCGAGCCACAAGAC
GATGACGTGAAGCAAAAGGCCCCGACTTCCTCCGAGTCAAAAGCCCCAACGACCGCATCCGACGCGGAAGAGTCC
ATCCCGAAACCGACGGACGACGCCTCGGCTGAGGCCACAGGCGCTCCAACGTCAGCGTCGTCCACCACGGGTCCC
GCTTCGGAGAAATGCAAGCAGATCAAGATGCCGGCCGACATGACGACACTGCGGGCACGCCTGGCGGCCAAGATC
GAAGCCCTTCGCGCAGCTAGGAAAGCTGATGGTCCAGACGGAAAGCCAATCCGCACACGACAGGAGCTCATCGAG
GCCCGACGCGCCAAGCAAGCACAACGCAAAGCGCACAAGCGAGAGCTCCGCATGCAGGCCAAGCAGGAAGAAGCA
CGCAAACGGGAGGAGGCTCTGGCATCCAATTCACCCGGCGTAGGCAGCCCTGCAGGCGTCGACCTCGACGAGAAT
CTTTCCTTTGGCCGCGTTGTCTTTGGCGACGGCACACAGGCATCTCACGACCTCAGCTACGTGCTCCAAAAGGGC
AAGCGCAAGGGCCCCTCGGACGCCAAGACGGCGCTGCTCAAGGTCCAAGGCCAGAAGAAGCGACTCGCCGAGCTC
GAGCCGGACAAGCGGGCCGACGTGGCGGATAAGGAGGCATGGCTCACGGCCCGGAGACGCGTCGAGGGCGACAAG
ATCCGCGACGACGAGGCCACACTGAAGAAGGCCGTTCGCCGCAAGGAGGCGGCCAAGAAGAAGAGCAAGGCTGCC
TGGCGCGAGCGCTCCCAGGGCATCGAGAAGGCGCAGAAGGAGCGGCAGAGGAAGCGCGAGACCAACATCCAGAAG
CGGCGCGACGACAAGATGCTCGGCAAGGCGGGCAAGAAAAAGGCCGCTGCTGGTGGGAAGAAGGGCAAGGCTGGC
CGTCCGGGGTTTGAGGGTAGCTTTGGCGTCGGTGGGCGGACCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail