Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4911
Gene name
LocationContig_466:7017..11548
Strand-
Gene length (bp)4531
Transcript length (bp)4359
Coding sequence length (bp)4359
Protein length (aa) 1453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 7.5E-149 1147 1413
PF18402 Thioredoxin_14 Thioredoxin-like domain 8.9E-63 379 621
PF18403 Thioredoxin_15 Thioredoxin-like domain 9.6E-54 633 829
PF18400 Thioredoxin_12 Thioredoxin-like domain 2.1E-42 23 199
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 1.5E-39 999 1107
PF18401 Thioredoxin_13 Thioredoxin-like domain 2.0E-36 247 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 8 1414 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 16 1426 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 11 1417 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 11 1414 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 11 1414 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 8 1414 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 16 1426 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 11 1417 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 11 1414 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 11 1414 0.0E+00
sp|Q9NYU1|UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens GN=UGGT2 PE=1 SV=4 1 1414 0.0E+00
sp|Q0WL80|UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana GN=UGGT PE=1 SV=1 11 1423 0.0E+00
sp|Q8T191|UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum GN=ggtA PE=1 SV=2 766 1410 3.0E-153
sp|P22023|KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE5 PE=1 SV=2 150 1359 6.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0006486 protein glycosylation Yes
GO:0019538 protein metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0046527 glucosyltransferase activity No
GO:0008152 metabolic process No
GO:0070085 glycosylation No
GO:0035251 UDP-glucosyltransferase activity No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT24 2.3E-135 1147 1394

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5033
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6527
Ophiocordyceps australis map64 (Brazil) OphauB2|4275
Ophiocordyceps camponoti-floridani Ophcf2|01772
Ophiocordyceps camponoti-rufipedis Ophun1|4911 (this protein)
Ophiocordyceps kimflemingae Ophio5|4972
Ophiocordyceps subramaniannii Hirsu2|2603

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4911
MTGAAVVAVPSVNVGMNAAFSAGPYLLELLETAAAENSTAYFPLIDRIASGYFATASSDAELYSKFLDLLVHDGH
VAGPEALSTFNLALTLRSAAPRIEAHYQYYSTAVEPSVDPNCLNWVLLEGKQYCSPQLDKPTREGLFTSGVTTLP
FDRTLGSGKEAVLYADPVSESFGDYHKALSEAARARNLQYRVRYRRNEANPHRPLPVSGYGVQLALKRTDYIVID
DREAAADRSQKPLTSGGFEDEVADLRPLSTSELASLGLKTASFIQNSKTPFATLIKLTQDFPRYSASVAAHNISE
PFNVEREMVAPGGINFLWMNGVQLIERQIEPFALVEMLRRERRLVDGFRRLGFTGKQAISILGHSAISTAKGDDE
TLRYDWTDKLEDGRAIIWLNDLENDSRYEDYPKSLVALLQRTFPGQIPQIGQNVFNIIAPVDLSNTEDIAFLSQI
ISLIRRGIPLRFGLVPLTPTADALAQAKIVMYLKEILNIDAVFAYLDGLSERKESGVNDQLFSTFVADAELLTDS
QRLSSSEVIESDTWADHFKSALHWVKRLKADAAVRPLFINGVFIPRDGNWMQTMSMKISGDLQNIQKQIFQGSLS
EDSESSSIFLKGALSGRNPYISVESDKALRMLDVSRVYSEHGSFFGAIPILEPYSESTKENWAVVTLLADLTSVN
GRELVLAALEFKRNSPGVRLELVHSPKDLSKASRVNSALLAQVELVKEMETIDQLTKVVDSVEVESVNDGYAPAL
SAFLDMAKVEVGKNIIILNGRIVGPISADEPFTADDFQQLLEYEQGHRMLPVYEAIDDLGLGDKLTSAMAAAKAT
SITALSTISDLPEGIFESAPTMRSTMYDAWDVDHATIEVGDAETASIHIAGLLDPVSEKGQRWTPILRVLSELDG
VYLKIILNPREKITELPLKRFFRYVMEPKPSFDDSGSVKALRASFEGLPSDVLLTAAMDVPPAWLVAPKESVHDL
DNIKLSSVKSNIDATYELEHILIEGHSREGRGAPPRGAQLTLATEKDPMVTDTIIMSNLGFFQFKANPGFYKIKL
KEGRTADIYMIESIGAQGWEATSGDEGTELALMDFQGTTLYPRLKRRPGMEQKDVLETSDSASSTGSIVSKGLKL
AEELLGGSKATKSASAQKHAEINIFSVASGHLYERMLNIMMVSVMRNTKHTVKFWFIEQFLSPSFKEFIPYMARE
YGFKYEMVTYKWPHWLRQQKEKQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMMDLVNLDLKGAPYGFTP
MCDSRTEMEGFRFWKQGYWSNYLRGRPYHISALYVVDLGRFRELAAGDRLRQQYHALSADPASLSNLDQDLPNHM
QFEIPIHSLPQEWLWCETWCSDESLAKARTIDLCNNPQTKEPKLDRAKRQVPEWTVYDEEIAALDRRRKGGDAAQ
SSEPEVNTKSRRLDGEDGQSRHTVDEL*
Coding >Ophun1|4911
ATGACAGGAGCGGCTGTCGTCGCCGTTCCATCAGTCAACGTTGGCATGAATGCGGCCTTCTCAGCTGGACCATAC
TTGCTCGAGCTGCTTGAAACCGCAGCAGCAGAGAACAGTACCGCCTACTTTCCGCTCATCGACCGAATCGCGAGT
GGATATTTTGCCACAGCTTCGTCCGATGCCGAGTTATACAGCAAGTTTCTCGATCTTCTCGTCCATGACGGCCAC
GTCGCGGGCCCCGAAGCTCTCTCAACCTTCAATCTCGCCTTGACACTGCGTTCGGCGGCCCCCCGAATTGAGGCT
CATTATCAATACTATTCGACAGCGGTTGAACCATCTGTTGACCCCAATTGCCTGAACTGGGTTCTGCTTGAAGGG
AAACAGTATTGCTCGCCGCAACTGGATAAACCTACAAGAGAAGGTCTCTTCACTTCCGGGGTGACGACGTTACCT
TTCGACCGGACCCTGGGATCTGGCAAGGAAGCCGTCCTCTACGCCGATCCCGTTTCCGAGTCGTTTGGCGACTAT
CATAAAGCTCTTTCTGAGGCAGCTCGCGCCCGAAACTTGCAATATCGCGTGAGATATCGACGAAATGAGGCGAAC
CCCCATCGCCCCCTGCCTGTCAGCGGTTACGGCGTCCAGTTGGCCCTGAAAAGAACAGACTACATCGTCATCGAT
GACAGGGAAGCTGCTGCTGATCGATCGCAAAAGCCTCTCACATCTGGTGGTTTCGAGGACGAGGTTGCGGACCTT
CGGCCTTTGTCTACTTCCGAACTTGCCTCGCTCGGCCTCAAGACTGCCTCCTTTATCCAAAACAGCAAAACGCCT
TTTGCGACGCTTATCAAGCTGACCCAAGATTTTCCTCGATACTCGGCTTCGGTTGCTGCCCACAACATCTCCGAA
CCCTTCAATGTCGAGCGCGAAATGGTTGCGCCCGGAGGAATCAATTTCTTGTGGATGAACGGTGTTCAACTCATC
GAGCGTCAGATCGAACCCTTTGCTCTGGTCGAGATGCTCCGCCGTGAGAGAAGACTCGTCGACGGTTTTCGCCGT
CTTGGCTTCACGGGTAAGCAAGCCATCTCGATCCTGGGCCACTCAGCCATCTCGACAGCCAAGGGGGACGATGAA
ACCCTGAGATACGACTGGACGGATAAGCTGGAGGATGGGCGAGCAATAATCTGGCTCAATGACCTTGAGAATGAT
TCTCGTTACGAGGACTATCCCAAGAGTCTAGTAGCGCTGTTGCAACGAACGTTTCCTGGACAGATACCTCAAATC
GGTCAAAATGTCTTCAACATCATCGCTCCAGTCGATCTGTCCAACACCGAAGATATCGCGTTTCTGTCTCAGATA
ATCTCCCTAATCAGACGCGGCATCCCTCTTCGATTTGGTTTGGTTCCTTTAACCCCCACCGCGGATGCCCTTGCT
CAAGCAAAGATTGTCATGTATCTGAAGGAGATTTTGAACATTGACGCCGTCTTTGCCTACCTTGACGGGCTTAGC
GAAAGGAAGGAGAGCGGAGTGAACGATCAGCTGTTCTCAACCTTCGTCGCGGACGCAGAGTTACTCACAGATTCT
CAACGGTTGTCGTCATCAGAGGTTATTGAATCCGACACCTGGGCCGATCATTTCAAGTCGGCCCTCCATTGGGTA
AAGAGGCTCAAGGCAGACGCGGCTGTGCGACCTCTTTTCATCAACGGTGTCTTCATCCCGCGTGACGGAAATTGG
ATGCAAACCATGAGCATGAAGATCAGTGGCGATCTCCAAAACATCCAGAAGCAGATTTTCCAGGGAAGTCTTAGT
GAAGACTCAGAGAGCTCGAGCATCTTCCTTAAAGGCGCTCTGTCGGGAAGGAACCCATACATCTCAGTCGAAAGC
GACAAGGCCCTCCGCATGCTAGACGTCAGTCGGGTCTACAGCGAGCATGGCAGCTTTTTTGGAGCAATTCCCATA
TTAGAGCCTTACTCGGAGTCGACCAAGGAGAATTGGGCAGTTGTGACGCTTCTGGCTGACTTGACAAGTGTCAAT
GGTCGGGAGCTCGTACTGGCTGCTTTGGAGTTCAAGCGCAACAGCCCCGGCGTGAGGCTCGAGCTCGTCCACAGT
CCTAAAGACTTGTCGAAGGCTTCCAGGGTCAACTCGGCTCTCCTGGCCCAAGTCGAGCTTGTCAAGGAAATGGAG
ACCATTGACCAGCTAACAAAAGTTGTCGATTCGGTTGAGGTCGAATCGGTCAATGATGGTTACGCCCCGGCCCTG
TCGGCGTTTCTTGACATGGCCAAGGTTGAAGTAGGCAAAAACATCATCATATTGAACGGCCGAATCGTCGGACCC
ATTTCCGCAGACGAGCCATTCACAGCCGACGACTTCCAGCAACTCTTGGAATATGAGCAAGGCCACCGCATGCTC
CCCGTCTACGAAGCAATCGATGATCTCGGGTTGGGCGACAAGCTGACCAGCGCCATGGCTGCAGCAAAAGCCACT
TCCATCACGGCCCTGTCCACGATATCCGATCTCCCAGAAGGAATCTTTGAATCGGCGCCGACGATGCGTTCCACC
ATGTACGATGCCTGGGATGTGGATCATGCTACCATTGAGGTCGGAGATGCCGAGACTGCCAGCATTCACATTGCC
GGACTCTTGGATCCCGTCAGCGAAAAGGGGCAACGATGGACGCCTATCCTGCGGGTTCTGTCGGAACTAGACGGA
GTCTACTTGAAGATTATACTCAACCCCCGCGAGAAGATTACCGAGCTCCCGTTAAAGCGGTTCTTCAGATACGTC
ATGGAACCAAAGCCATCGTTCGACGACAGTGGCAGTGTCAAAGCTCTGAGGGCAAGCTTCGAGGGTCTGCCTTCG
GACGTGCTGCTGACGGCCGCCATGGACGTCCCTCCAGCGTGGCTGGTGGCTCCAAAGGAGTCTGTTCACGACCTG
GACAATATCAAGTTGAGCTCCGTCAAGTCAAACATCGACGCTACCTACGAACTCGAACACATCCTCATCGAGGGA
CACTCCCGCGAAGGACGAGGAGCACCACCCAGAGGGGCGCAACTGACGCTGGCCACGGAGAAAGACCCCATGGTG
ACGGACACGATCATCATGTCGAATCTCGGTTTCTTCCAGTTCAAGGCAAACCCGGGCTTCTATAAGATCAAGCTG
AAAGAGGGCCGCACGGCAGACATCTACATGATTGAGAGCATCGGCGCCCAAGGATGGGAGGCCACCTCAGGCGAC
GAGGGAACCGAGCTGGCCCTGATGGATTTCCAGGGAACGACGCTGTACCCACGCCTCAAACGACGGCCCGGGATG
GAGCAGAAAGACGTGCTGGAGACGTCTGATAGCGCCTCATCCACCGGCAGCATCGTATCCAAGGGCCTCAAGCTC
GCCGAAGAGCTCCTCGGTGGCTCCAAGGCCACCAAGTCGGCATCAGCGCAAAAGCACGCCGAGATCAACATCTTT
TCCGTCGCCAGCGGCCACCTGTACGAACGCATGCTCAACATCATGATGGTGTCGGTGATGCGCAACACAAAACAC
ACGGTCAAATTCTGGTTCATCGAGCAATTCCTCTCGCCCTCGTTCAAAGAGTTCATCCCCTACATGGCCCGCGAA
TACGGCTTCAAGTACGAGATGGTCACCTACAAGTGGCCACACTGGCTACGACAACAAAAGGAAAAGCAGCGTGAA
ATCTGGGGCTACAAGATCCTCTTCCTCGACGTCCTCTTCCCCCTCTCCCTCGACAAGGTCATCTTCGTCGACGCA
GACCAAATCGTCCGCACCGACATGATGGACCTGGTCAACCTCGATCTCAAGGGCGCCCCCTACGGCTTCACACCC
ATGTGCGACTCGCGCACCGAGATGGAGGGCTTCCGCTTCTGGAAGCAAGGCTACTGGTCCAATTACCTCCGCGGC
CGACCCTATCACATCTCGGCCCTCTACGTCGTCGACCTTGGTCGCTTCAGGGAGCTGGCAGCCGGTGACCGTCTC
CGACAGCAGTACCACGCCCTCAGCGCCGATCCCGCCAGCCTGTCCAACCTGGATCAGGACCTGCCGAACCACATG
CAGTTTGAGATTCCCATCCATAGCCTACCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGACGAGAGTCTC
GCAAAGGCTCGAACCATCGACCTCTGTAACAATCCGCAGACCAAGGAGCCCAAGCTCGACCGCGCGAAGAGGCAG
GTTCCCGAGTGGACCGTCTACGATGAAGAGATTGCTGCCCTGGACAGGAGGCGGAAAGGCGGCGATGCTGCTCAG
TCCAGTGAACCTGAGGTCAACACCAAGAGTCGCAGGCTAGACGGGGAGGACGGACAGAGTCGTCACACTGTAGAC
GAGTTGTGA
Transcript >Ophun1|4911
ATGACAGGAGCGGCTGTCGTCGCCGTTCCATCAGTCAACGTTGGCATGAATGCGGCCTTCTCAGCTGGACCATAC
TTGCTCGAGCTGCTTGAAACCGCAGCAGCAGAGAACAGTACCGCCTACTTTCCGCTCATCGACCGAATCGCGAGT
GGATATTTTGCCACAGCTTCGTCCGATGCCGAGTTATACAGCAAGTTTCTCGATCTTCTCGTCCATGACGGCCAC
GTCGCGGGCCCCGAAGCTCTCTCAACCTTCAATCTCGCCTTGACACTGCGTTCGGCGGCCCCCCGAATTGAGGCT
CATTATCAATACTATTCGACAGCGGTTGAACCATCTGTTGACCCCAATTGCCTGAACTGGGTTCTGCTTGAAGGG
AAACAGTATTGCTCGCCGCAACTGGATAAACCTACAAGAGAAGGTCTCTTCACTTCCGGGGTGACGACGTTACCT
TTCGACCGGACCCTGGGATCTGGCAAGGAAGCCGTCCTCTACGCCGATCCCGTTTCCGAGTCGTTTGGCGACTAT
CATAAAGCTCTTTCTGAGGCAGCTCGCGCCCGAAACTTGCAATATCGCGTGAGATATCGACGAAATGAGGCGAAC
CCCCATCGCCCCCTGCCTGTCAGCGGTTACGGCGTCCAGTTGGCCCTGAAAAGAACAGACTACATCGTCATCGAT
GACAGGGAAGCTGCTGCTGATCGATCGCAAAAGCCTCTCACATCTGGTGGTTTCGAGGACGAGGTTGCGGACCTT
CGGCCTTTGTCTACTTCCGAACTTGCCTCGCTCGGCCTCAAGACTGCCTCCTTTATCCAAAACAGCAAAACGCCT
TTTGCGACGCTTATCAAGCTGACCCAAGATTTTCCTCGATACTCGGCTTCGGTTGCTGCCCACAACATCTCCGAA
CCCTTCAATGTCGAGCGCGAAATGGTTGCGCCCGGAGGAATCAATTTCTTGTGGATGAACGGTGTTCAACTCATC
GAGCGTCAGATCGAACCCTTTGCTCTGGTCGAGATGCTCCGCCGTGAGAGAAGACTCGTCGACGGTTTTCGCCGT
CTTGGCTTCACGGGTAAGCAAGCCATCTCGATCCTGGGCCACTCAGCCATCTCGACAGCCAAGGGGGACGATGAA
ACCCTGAGATACGACTGGACGGATAAGCTGGAGGATGGGCGAGCAATAATCTGGCTCAATGACCTTGAGAATGAT
TCTCGTTACGAGGACTATCCCAAGAGTCTAGTAGCGCTGTTGCAACGAACGTTTCCTGGACAGATACCTCAAATC
GGTCAAAATGTCTTCAACATCATCGCTCCAGTCGATCTGTCCAACACCGAAGATATCGCGTTTCTGTCTCAGATA
ATCTCCCTAATCAGACGCGGCATCCCTCTTCGATTTGGTTTGGTTCCTTTAACCCCCACCGCGGATGCCCTTGCT
CAAGCAAAGATTGTCATGTATCTGAAGGAGATTTTGAACATTGACGCCGTCTTTGCCTACCTTGACGGGCTTAGC
GAAAGGAAGGAGAGCGGAGTGAACGATCAGCTGTTCTCAACCTTCGTCGCGGACGCAGAGTTACTCACAGATTCT
CAACGGTTGTCGTCATCAGAGGTTATTGAATCCGACACCTGGGCCGATCATTTCAAGTCGGCCCTCCATTGGGTA
AAGAGGCTCAAGGCAGACGCGGCTGTGCGACCTCTTTTCATCAACGGTGTCTTCATCCCGCGTGACGGAAATTGG
ATGCAAACCATGAGCATGAAGATCAGTGGCGATCTCCAAAACATCCAGAAGCAGATTTTCCAGGGAAGTCTTAGT
GAAGACTCAGAGAGCTCGAGCATCTTCCTTAAAGGCGCTCTGTCGGGAAGGAACCCATACATCTCAGTCGAAAGC
GACAAGGCCCTCCGCATGCTAGACGTCAGTCGGGTCTACAGCGAGCATGGCAGCTTTTTTGGAGCAATTCCCATA
TTAGAGCCTTACTCGGAGTCGACCAAGGAGAATTGGGCAGTTGTGACGCTTCTGGCTGACTTGACAAGTGTCAAT
GGTCGGGAGCTCGTACTGGCTGCTTTGGAGTTCAAGCGCAACAGCCCCGGCGTGAGGCTCGAGCTCGTCCACAGT
CCTAAAGACTTGTCGAAGGCTTCCAGGGTCAACTCGGCTCTCCTGGCCCAAGTCGAGCTTGTCAAGGAAATGGAG
ACCATTGACCAGCTAACAAAAGTTGTCGATTCGGTTGAGGTCGAATCGGTCAATGATGGTTACGCCCCGGCCCTG
TCGGCGTTTCTTGACATGGCCAAGGTTGAAGTAGGCAAAAACATCATCATATTGAACGGCCGAATCGTCGGACCC
ATTTCCGCAGACGAGCCATTCACAGCCGACGACTTCCAGCAACTCTTGGAATATGAGCAAGGCCACCGCATGCTC
CCCGTCTACGAAGCAATCGATGATCTCGGGTTGGGCGACAAGCTGACCAGCGCCATGGCTGCAGCAAAAGCCACT
TCCATCACGGCCCTGTCCACGATATCCGATCTCCCAGAAGGAATCTTTGAATCGGCGCCGACGATGCGTTCCACC
ATGTACGATGCCTGGGATGTGGATCATGCTACCATTGAGGTCGGAGATGCCGAGACTGCCAGCATTCACATTGCC
GGACTCTTGGATCCCGTCAGCGAAAAGGGGCAACGATGGACGCCTATCCTGCGGGTTCTGTCGGAACTAGACGGA
GTCTACTTGAAGATTATACTCAACCCCCGCGAGAAGATTACCGAGCTCCCGTTAAAGCGGTTCTTCAGATACGTC
ATGGAACCAAAGCCATCGTTCGACGACAGTGGCAGTGTCAAAGCTCTGAGGGCAAGCTTCGAGGGTCTGCCTTCG
GACGTGCTGCTGACGGCCGCCATGGACGTCCCTCCAGCGTGGCTGGTGGCTCCAAAGGAGTCTGTTCACGACCTG
GACAATATCAAGTTGAGCTCCGTCAAGTCAAACATCGACGCTACCTACGAACTCGAACACATCCTCATCGAGGGA
CACTCCCGCGAAGGACGAGGAGCACCACCCAGAGGGGCGCAACTGACGCTGGCCACGGAGAAAGACCCCATGGTG
ACGGACACGATCATCATGTCGAATCTCGGTTTCTTCCAGTTCAAGGCAAACCCGGGCTTCTATAAGATCAAGCTG
AAAGAGGGCCGCACGGCAGACATCTACATGATTGAGAGCATCGGCGCCCAAGGATGGGAGGCCACCTCAGGCGAC
GAGGGAACCGAGCTGGCCCTGATGGATTTCCAGGGAACGACGCTGTACCCACGCCTCAAACGACGGCCCGGGATG
GAGCAGAAAGACGTGCTGGAGACGTCTGATAGCGCCTCATCCACCGGCAGCATCGTATCCAAGGGCCTCAAGCTC
GCCGAAGAGCTCCTCGGTGGCTCCAAGGCCACCAAGTCGGCATCAGCGCAAAAGCACGCCGAGATCAACATCTTT
TCCGTCGCCAGCGGCCACCTGTACGAACGCATGCTCAACATCATGATGGTGTCGGTGATGCGCAACACAAAACAC
ACGGTCAAATTCTGGTTCATCGAGCAATTCCTCTCGCCCTCGTTCAAAGAGTTCATCCCCTACATGGCCCGCGAA
TACGGCTTCAAGTACGAGATGGTCACCTACAAGTGGCCACACTGGCTACGACAACAAAAGGAAAAGCAGCGTGAA
ATCTGGGGCTACAAGATCCTCTTCCTCGACGTCCTCTTCCCCCTCTCCCTCGACAAGGTCATCTTCGTCGACGCA
GACCAAATCGTCCGCACCGACATGATGGACCTGGTCAACCTCGATCTCAAGGGCGCCCCCTACGGCTTCACACCC
ATGTGCGACTCGCGCACCGAGATGGAGGGCTTCCGCTTCTGGAAGCAAGGCTACTGGTCCAATTACCTCCGCGGC
CGACCCTATCACATCTCGGCCCTCTACGTCGTCGACCTTGGTCGCTTCAGGGAGCTGGCAGCCGGTGACCGTCTC
CGACAGCAGTACCACGCCCTCAGCGCCGATCCCGCCAGCCTGTCCAACCTGGATCAGGACCTGCCGAACCACATG
CAGTTTGAGATTCCCATCCATAGCCTACCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGACGAGAGTCTC
GCAAAGGCTCGAACCATCGACCTCTGTAACAATCCGCAGACCAAGGAGCCCAAGCTCGACCGCGCGAAGAGGCAG
GTTCCCGAGTGGACCGTCTACGATGAAGAGATTGCTGCCCTGGACAGGAGGCGGAAAGGCGGCGATGCTGCTCAG
TCCAGTGAACCTGAGGTCAACACCAAGAGTCGCAGGCTAGACGGGGAGGACGGACAGAGTCGTCACACTGTAGAC
GAGTTGTGA
Gene >Ophun1|4911
ATGACAGGAGCGGCTGTCGTCGCCGTTCCATCAGTCAACGTTGGCATGAATGCGGCCTTCTCAGCTGGACCATAC
TTGCTCGAGCTGCTGTACGTCCGCTCCCATGATACGGATAGATGAGATGCAGATGCTGATACAGCACCAGTGAAA
CCGCAGCAGCAGAGAACAGTACCGCCTACTTTCCGCTCATCGACCGAATCGCGAGTGGATATTTTGCCACAGCTT
CGTCCGATGCCGAGTTATACAGCAAGTTTCTCGATCTTCTCGTCCATGACGGCCACGTCGCGGGCCCCGAAGCTC
TCTCAACCTTCAATCTCGCCTTGACACTGCGTTCGGCGGCCCCCCGAATTGAGGCTCATTATCAATACTATTCGA
CAGCGGTTGAACCATCTGTTGACCCCAATTGCCTGAACTGGGTTCTGCTTGAAGGGAAACAGTATTGCTCGCCGC
AACTGGATAAACCTACAAGAGAAGGTCTCTTCACTTCGTAAGTTGTCAAGACAATGGATGCTCGGTTCCGTCGCA
TTGTTCTGACTCAATCTCGGATGCAGCGGGGTGACGACGTTACCTTTCGACCGGACCCTGGGATCTGGCAAGGAA
GCCGTCCTCTACGCCGATCCCGTTTCCGAGTCGTTTGGCGACTATCATAAAGCTCTTTCTGAGGCAGCTCGCGCC
CGAAACTTGCAATATCGCGTGAGATATCGACGAAATGAGGCGAACCCCCATCGCCCCCTGCCTGTCAGCGGTTAC
GGCGTCCAGTTGGCCCTGAAAAGAACAGACTACATCGTCATCGATGACAGGGAAGCTGCTGCTGATCGATCGCAA
AAGCCTCTCACATCTGGTGGTTTCGAGGACGAGGTTGCGGACCTTCGGCCTTTGTCTACTTCCGAACTTGCCTCG
CTCGGCCTCAAGACTGCCTCCTTTATCCAAAACAGCAAAACGCCTTTTGCGACGCTTATCAAGCTGACCCAAGAT
TTTCCTCGATACTCGGCTTCGGTTGCTGCCCACAACATCTCCGAACCCTTCAATGTCGAGCGCGAAATGGTTGCG
CCCGGAGGAATCAATTTCTTGTGGATGAACGGTGTTCAACTCATCGAGCGTCAGATCGAACCCTTTGCTCTGGTC
GAGATGCTCCGCCGTGAGAGAAGACTCGTCGACGGTTTTCGCCGTCTTGGCTTCACGGGTAAGCAAGCCATCTCG
ATCCTGGGCCACTCAGCCATCTCGACAGCCAAGGGGGACGATGAAACCCTGAGATACGACTGGACGGATAAGCTG
GAGGATGGGCGAGCAATAATCTGGCTCAATGACCTTGAGAATGATTCTCGTTACGAGGACTATCCCAAGAGTCTA
GTAGCGGTAAGTTTGCTGTTGCTAGATGGAGTTTTACTTCAACTAATCGATGAGATAGCTGTTGCAACGAACGTT
TCCTGGACAGATACCTCAAATCGGTCAAAATGTCTTCAACATCATCGCTCCAGTCGATCTGTCCAACACCGAAGA
TATCGCGTTTCTGTCTCAGATAATCTCCCTAATCAGACGCGGCATCCCTCTTCGATTTGGTTTGGTTCCTTTAAC
CCCCACCGCGGATGCCCTTGCTCAAGCAAAGATTGTCATGTATCTGAAGGAGATTTTGAACATTGACGCCGTCTT
TGCCTACCTTGACGGGCTTAGCGAAAGGAAGGAGAGCGGAGTGAACGATCAGCTGTTCTCAACCTTCGTCGCGGA
CGCAGAGTTACTCACAGATTCTCAACGGTTGTCGTCATCAGAGGTTATTGAATCCGACACCTGGGCCGATCATTT
CAAGTCGGCCCTCCATTGGGTAAAGAGGCTCAAGGCAGACGCGGCTGTGCGACCTCTTTTCATCAACGGTGTCTT
CATCCCGCGTGACGGAAATTGGATGCAAACCATGAGCATGAAGATCAGTGGCGATCTCCAAAACATCCAGAAGCA
GATTTTCCAGGGAAGTCTTAGTGAAGACTCAGAGAGCTCGAGCATCTTCCTTAAAGGCGCTCTGTCGGGAAGGAA
CCCATACATCTCAGTCGAAAGCGACAAGGCCCTCCGCATGCTAGACGTCAGTCGGGTCTACAGCGAGCATGGCAG
CTTTTTTGGAGCAATTCCCATATTAGAGCCTTACTCGGAGTCGACCAAGGAGAATTGGGCAGTTGTGACGCTTCT
GGCTGACTTGACAAGTGTCAATGGTCGGGAGCTCGTACTGGCTGCTTTGGAGTTCAAGCGCAACAGCCCCGGCGT
GAGGCTCGAGCTCGTCCACAGTCCTAAAGACTTGTCGAAGGCTTCCAGGGTCAACTCGGCTCTCCTGGCCCAAGT
CGAGCTTGTCAAGGAAATGGAGACCATTGACCAGCTAACAAAAGTTGTCGATTCGGTTGAGGTCGAATCGGTCAA
TGATGGTTACGCCCCGGCCCTGTCGGCGTTTCTTGACATGGCCAAGGTTGAAGTAGGCAAAAACATCATCATATT
GAACGGCCGAATCGTCGGACCCATTTCCGCAGACGAGCCATTCACAGCCGACGACTTCCAGCAACTCTTGGAATA
TGAGCAAGGCCACCGCATGCTCCCCGTCTACGAAGCAATCGATGATCTCGGGTTGGGCGACAAGCTGACCAGCGC
CATGGCTGCAGCAAAAGCCACTTCCATCACGGCCCTGTCCACGATATCCGATCTCCCAGAAGGAATCTTTGAATC
GGCGCCGACGATGCGTTCCACCATGTACGATGCCTGGGATGTGGATCATGCTACCATTGAGGTCGGAGATGCCGA
GACTGCCAGCATTCACATTGCCGGACTCTTGGATCCCGTCAGCGAAAAGGGGCAACGATGGACGCCTATCCTGCG
GGTTCTGTCGGAACTAGACGGAGTCTACTTGAAGATTATACTCAACCCCCGCGAGAAGATTACCGAGCTCCCGTT
AAAGCGGTTCTTCAGATACGTCATGGAACCAAAGCCATCGTTCGACGACAGTGGCAGTGTCAAAGCTCTGAGGGC
AAGCTTCGAGGGTCTGCCTTCGGACGTGCTGCTGACGGCCGCCATGGACGTCCCTCCAGCGTGGCTGGTGGCTCC
AAAGGAGTCTGTTCACGACCTGGACAATATCAAGTTGAGCTCCGTCAAGTCAAACATCGACGCTACCTACGAACT
CGAACACATCCTCATCGAGGGACACTCCCGCGAAGGACGAGGAGCACCACCCAGAGGGGCGCAACTGACGCTGGC
CACGGAGAAAGACCCCATGGTGACGGACACGATCATCATGTCGAATCTCGGTTTCTTCCAGTTCAAGGCAAACCC
GGGCTTCTATAAGATCAAGCTGAAAGAGGGCCGCACGGCAGACATCTACATGATTGAGAGCATCGGCGCCCAAGG
ATGGGAGGCCACCTCAGGCGACGAGGGAACCGAGCTGGCCCTGATGGATTTCCAGGGAACGACGCTGTACCCACG
CCTCAAACGACGGCCCGGGATGGAGCAGAAAGACGTGCTGGAGACGTCTGATAGCGCCTCATCCACCGGCAGCAT
CGTATCCAAGGGCCTCAAGCTCGCCGAAGAGCTCCTCGGTGGCTCCAAGGCCACCAAGTCGGCATCAGCGCAAAA
GCACGCCGAGATCAACATCTTTTCCGTCGCCAGCGGCCACCTGTACGAACGCATGCTCAACATCATGATGGTGTC
GGTGATGCGCAACACAAAACACACGGTCAAATTCTGGTTCATCGAGCAATTCCTCTCGCCCTCGTTCAAAGAGTT
CATCCCCTACATGGCCCGCGAATACGGCTTCAAGTACGAGATGGTCACCTACAAGTGGCCACACTGGCTACGACA
ACAAAAGGAAAAGCAGCGTGAAATCTGGGGCTACAAGATCCTCTTCCTCGACGTCCTCTTCCCCCTCTCCCTCGA
CAAGGTCATCTTCGTCGACGCAGACCAAATCGTCCGCACCGACATGATGGACCTGGTCAACCTCGATCTCAAGGG
CGCCCCCTACGGCTTCACACCCATGTGCGACTCGCGCACCGAGATGGAGGGCTTCCGCTTCTGGAAGCAAGGCTA
CTGGTCCAATTACCTCCGCGGCCGACCCTATCACATCTCGGCCCTCTACGTCGTCGACCTTGGTCGCTTCAGGGA
GCTGGCAGCCGGTGACCGTCTCCGACAGCAGTACCACGCCCTCAGCGCCGATCCCGCCAGCCTGTCCAACCTGGA
TCAGGACCTGCCGAACCACATGCAGTTTGAGATTCCCATCCATAGCCTACCGCAGGAGTGGCTGTGGTGCGAGAC
GTGGTGCAGCGACGAGAGTCTCGCAAAGGCTCGAACCATCGACCTCTGTAACAATCCGCAGACCAAGGAGCCCAA
GCTCGACCGCGCGAAGAGGCAGGTTCCCGAGTGGACCGTCTACGATGAAGAGATTGCTGCCCTGGACAGGAGGCG
GAAAGGCGGCGATGCTGCTCAGTCCAGTGAACCTGAGGTCAACACCAAGAGTCGCAGGCTAGACGGGGAGGACGG
ACAGAGTCGTCACACTGTAGACGAGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail