Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|491
Gene name
LocationContig_114:29400..31227
Strand+
Gene length (bp)1827
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 3.3E-79 53 493
PF07690 MFS_1 Major Facilitator Superfamily 8.7E-25 58 414
PF07690 MFS_1 Major Facilitator Superfamily 5.4E-10 305 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 41 514 1.0E-85
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 46 498 6.0E-47
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 47 507 2.0E-41
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 92 499 1.0E-35
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 40 496 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 41 514 1.0E-85
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 46 498 6.0E-47
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 47 507 2.0E-41
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 92 499 1.0E-35
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 40 496 1.0E-34
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 40 496 3.0E-33
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 40 496 6.0E-33
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 1 499 9.0E-33
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 40 496 1.0E-32
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 89 499 1.0E-31
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 77 499 1.0E-30
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 91 499 1.0E-30
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 21 499 2.0E-30
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 47 504 2.0E-30
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 91 508 3.0E-30
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 91 499 4.0E-30
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 27 505 1.0E-29
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 63 494 2.0E-29
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 92 496 3.0E-29
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 91 508 4.0E-29
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 49 491 5.0E-29
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 50 500 8.0E-29
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 98 506 1.0E-28
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 63 493 4.0E-28
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 51 508 6.0E-28
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 91 499 4.0E-27
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 40 496 4.0E-27
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 40 496 4.0E-27
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 49 493 7.0E-27
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 5 494 7.0E-27
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 92 499 8.0E-27
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 82 490 8.0E-27
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 92 499 9.0E-27
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 40 496 1.0E-26
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 44 510 2.0E-26
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 63 493 3.0E-26
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 100 494 3.0E-26
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 48 495 4.0E-26
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 92 496 6.0E-26
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 92 498 7.0E-26
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 40 496 9.0E-26
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 101 499 1.0E-25
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 43 489 1.0E-25
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 40 496 1.0E-25
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 92 499 2.0E-25
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 40 497 2.0E-25
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 37 498 2.0E-25
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 101 499 3.0E-25
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 42 493 3.0E-25
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 53 494 3.0E-25
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 92 499 5.0E-25
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 7 499 5.0E-25
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 7 499 5.0E-25
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 40 496 6.0E-25
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 48 493 1.0E-24
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 100 490 1.0E-24
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 100 490 1.0E-24
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 40 496 2.0E-24
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 100 490 5.0E-24
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 1 499 6.0E-24
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 51 493 7.0E-24
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 21 490 1.0E-23
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 92 510 1.0E-23
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 92 499 2.0E-23
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 48 496 2.0E-23
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 48 496 2.0E-23
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 100 497 2.0E-23
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 49 490 3.0E-23
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 49 490 3.0E-23
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 53 503 3.0E-23
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 91 499 7.0E-23
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 91 499 1.0E-22
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 38 496 1.0E-22
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 91 499 4.0E-22
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 40 496 8.0E-22
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 63 493 9.0E-22
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 13 500 1.0E-21
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 54 489 2.0E-21
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 100 494 2.0E-21
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 13 500 1.0E-20
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 103 493 1.0E-20
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 114 384 2.0E-20
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 53 496 2.0E-20
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 42 489 2.0E-20
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 53 494 2.0E-20
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 99 373 4.0E-20
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 97 494 5.0E-20
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 112 496 6.0E-20
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 44 489 9.0E-20
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 92 498 1.0E-19
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 100 412 2.0E-19
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 48 500 3.0E-19
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 97 370 4.0E-19
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 116 424 4.0E-19
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 97 506 4.0E-19
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 33 379 5.0E-19
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 114 493 7.0E-19
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 116 373 8.0E-19
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 97 498 1.0E-18
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 56 502 1.0E-18
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 97 506 2.0E-18
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 39 490 2.0E-18
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 100 379 3.0E-18
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 19 493 3.0E-18
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 19 493 3.0E-18
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 19 493 3.0E-18
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 19 493 3.0E-18
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 103 489 4.0E-18
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 19 493 4.0E-18
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 42 492 5.0E-18
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 97 492 6.0E-18
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 100 379 8.0E-18
sp|Q12407|YD199_YEAST Putative metabolite transport protein YDL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL199C PE=1 SV=1 43 490 8.0E-18
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 53 497 1.0E-17
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 47 489 1.0E-17
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 97 496 2.0E-17
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 98 379 3.0E-17
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 99 493 4.0E-17
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 90 496 4.0E-17
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 12 371 4.0E-17
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 97 491 4.0E-17
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 93 395 5.0E-17
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 37 504 5.0E-17
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 65 496 6.0E-17
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 90 490 1.0E-16
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 97 493 1.0E-16
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 101 491 2.0E-16
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 98 493 2.0E-16
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 39 496 3.0E-16
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 111 490 4.0E-16
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 44 493 5.0E-16
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 97 493 6.0E-16
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 12 371 6.0E-16
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 97 490 6.0E-16
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 37 504 6.0E-16
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 97 494 2.0E-15
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 111 490 2.0E-15
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 111 490 2.0E-15
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 97 493 2.0E-15
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 55 493 3.0E-15
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 54 493 3.0E-15
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 55 493 3.0E-15
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 79 489 4.0E-15
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 97 490 9.0E-15
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 111 493 1.0E-14
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 42 378 1.0E-14
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 111 490 1.0E-14
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 114 496 2.0E-14
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 111 490 2.0E-14
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 82 371 2.0E-14
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 97 493 2.0E-14
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 100 493 2.0E-14
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 97 496 3.0E-14
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 101 491 3.0E-14
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 97 493 3.0E-14
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 51 267 7.0E-14
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 101 491 7.0E-14
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 114 496 7.0E-14
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 97 496 7.0E-14
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 98 502 8.0E-14
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 97 496 9.0E-14
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 143 490 1.0E-13
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 97 500 1.0E-13
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 97 493 2.0E-13
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 111 490 2.0E-13
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 99 365 2.0E-13
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 101 375 3.0E-13
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 114 394 3.0E-13
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 98 502 3.0E-13
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 97 494 3.0E-13
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 111 490 4.0E-13
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 97 496 4.0E-13
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 58 368 5.0E-13
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 100 490 6.0E-13
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 97 490 7.0E-13
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 97 496 8.0E-13
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 111 490 1.0E-12
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 86 375 1.0E-12
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 97 491 1.0E-12
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 97 496 1.0E-12
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 111 490 1.0E-12
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 99 368 2.0E-12
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 111 490 2.0E-12
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 97 510 2.0E-12
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 97 496 4.0E-12
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 111 490 5.0E-12
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 89 267 6.0E-12
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 111 490 6.0E-12
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 54 378 9.0E-12
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 80 493 1.0E-11
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 111 490 1.0E-11
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 97 368 2.0E-11
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 80 493 2.0E-11
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 57 507 3.0E-11
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 97 496 5.0E-11
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 112 383 6.0E-11
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 97 393 6.0E-11
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 99 373 9.0E-11
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 145 493 9.0E-11
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 97 493 1.0E-10
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 97 494 1.0E-10
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 97 504 1.0E-10
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 99 491 3.0E-10
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 74 267 4.0E-10
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 97 335 4.0E-10
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 78 494 5.0E-10
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 75 496 7.0E-10
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 99 287 9.0E-10
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 98 504 1.0E-09
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 59 282 4.0E-09
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 97 504 9.0E-09
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 89 317 1.0E-08
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 89 317 1.0E-08
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 59 282 3.0E-08
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 77 496 3.0E-08
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 73 514 3.0E-08
sp|Q2KIV1|S22A9_BOVIN Solute carrier family 22 member 9 OS=Bos taurus GN=SLC22A9 PE=2 SV=1 64 306 3.0E-08
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 77 371 4.0E-08
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 17 465 5.0E-08
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 58 253 6.0E-08
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 97 378 7.0E-08
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 89 317 1.0E-07
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 100 303 1.0E-07
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 82 455 3.0E-07
sp|P76230|YDJK_ECOLI Putative metabolite transport protein YdjK OS=Escherichia coli (strain K12) GN=ydjK PE=3 SV=1 40 456 4.0E-07
sp|Q4W8A2|S22A8_MACFA Solute carrier family 22 member 8 OS=Macaca fascicularis GN=SLC22A8 PE=2 SV=1 64 282 5.0E-07
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 97 493 5.0E-07
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 54 335 5.0E-07
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 36 492 8.0E-07
sp|Q9P290|S22AH_RAT Solute carrier family 22 member 17 OS=Rattus norvegicus GN=Slc22a17 PE=2 SV=2 64 442 2.0E-06
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 145 496 2.0E-06
sp|Q3SZQ2|S22AH_BOVIN Solute carrier family 22 member 17 OS=Bos taurus GN=SLC22A17 PE=2 SV=1 64 442 4.0E-06
sp|O64515|OCT2_ARATH Organic cation/carnitine transporter 2 OS=Arabidopsis thaliana GN=OCT2 PE=2 SV=1 98 253 6.0E-06
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 99 377 6.0E-06
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 99 377 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 88 110 22
3 120 139 19
4 146 168 22
5 179 201 22
6 208 230 22
7 300 322 22
8 368 386 18
9 396 418 22
10 430 452 22
11 457 479 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|491
MSSSPAVEAVGEKEAREAIVEVQGDAPFSGSAAAAAPLDPFSRTSFQLYAILLVAALNATASGFDGSIFSSINAM
AQYQDYFNHKELGSATGLIFMIFTVGSMVGSLFSGPVCDNFGRRIGMAAGSVLIMTGAAVQTAARGNASLLAGRF
VLGFGVAIGTSSAPTYALELAPPQWRARIVGYYNTFFYSGSILATGVAYASSRSTGEIAFRLPLSLQLVFPLFIL
IGTAFIPESPRWLTMWGRKDEAGRILAKYHGGGNANHPLVLLELREFEANIELQKSSSVWNYWSLVETHNARWRF
TMMAFMSIFAQLSGNSVLTYYLPSMYRQVGITTTERRLLLTFINSIVSCIGAIAGSATNDRMGRRSKLWIGSFVL
AGLLGAVTGFSSQFGDASKKVGIFLFGFAYSYVYTPLTSTYCGEVLANPTRAKGMGVHVLLGNMANLYNAYVTAI
AFEAIGWRYYLVFVGLNILYGVLWYVFGVETRGRTLEEMDAVFDAKFPPRAALQKPTALQVKGS*
Coding >Ophun1|491
ATGTCATCGAGTCCTGCCGTCGAAGCTGTCGGGGAAAAGGAGGCTCGAGAAGCCATCGTCGAGGTCCAAGGCGAT
GCTCCGTTCTCCGGTTCTGCCGCCGCTGCCGCGCCTTTGGATCCCTTCTCCCGGACGAGCTTTCAGCTGTATGCC
ATCCTGCTTGTTGCGGCTCTCAACGCAACGGCCTCTGGATTCGATGGGTCCATCTTTAGTTCCATCAACGCTATG
GCGCAGTATCAAGACTACTTCAATCACAAAGAACTCGGCTCGGCCACCGGCCTCATCTTCATGATATTCACCGTT
GGGAGCATGGTCGGCTCTCTCTTCTCCGGTCCCGTCTGCGACAACTTCGGCCGCCGAATCGGCATGGCCGCCGGC
TCCGTCTTGATAATGACCGGGGCTGCCGTCCAGACAGCTGCCAGAGGCAACGCCTCGCTCCTCGCTGGCCGCTTC
GTCCTGGGCTTTGGCGTCGCCATTGGCACCTCGTCTGCTCCGACGTATGCGCTTGAACTGGCTCCGCCGCAGTGG
CGAGCACGCATTGTCGGCTACTACAATACCTTCTTCTACTCCGGGTCTATCCTGGCAACCGGAGTCGCCTACGCC
TCGAGCAGGTCTACAGGCGAGATTGCCTTCCGCCTCCCGCTATCTCTCCAGCTCGTCTTCCCCCTCTTCATCCTC
ATCGGAACCGCCTTCATCCCCGAATCGCCACGCTGGCTCACCATGTGGGGGAGAAAGGACGAAGCCGGCCGCATC
CTGGCCAAGTATCACGGAGGTGGCAATGCGAACCACCCGCTGGTCCTCCTCGAGCTGCGAGAGTTTGAAGCCAAC
ATTGAACTCCAAAAGTCTTCCAGCGTCTGGAACTACTGGTCTCTCGTGGAGACGCACAACGCTCGCTGGCGCTTT
ACCATGATGGCTTTCATGTCCATCTTTGCCCAGCTGTCGGGAAACTCGGTCCTGACGTACTATCTGCCATCCATG
TATAGGCAGGTTGGGATCACGACGACTGAGCGCCGCCTGCTTCTCACCTTTATCAACTCCATCGTGTCCTGCATC
GGGGCCATAGCCGGCTCCGCAACGAATGATCGGATGGGACGACGGTCGAAACTGTGGATTGGTAGTTTCGTCCTT
GCCGGCCTCTTGGGCGCCGTCACGGGCTTCTCCAGTCAGTTTGGCGATGCCAGCAAGAAAGTAGGGATCTTTCTC
TTCGGCTTTGCGTATTCCTATGTCTACACCCCGTTGACTAGCACCTACTGCGGCGAGGTGCTAGCGAACCCAACT
CGAGCCAAGGGAATGGGCGTGCACGTCCTCCTGGGGAACATGGCCAACCTTTACAACGCATACGTCACGGCCATC
GCGTTCGAAGCCATAGGCTGGCGCTATTACCTCGTCTTTGTCGGTCTCAACATCTTGTACGGTGTTTTGTGGTAC
GTCTTTGGCGTCGAAACTCGTGGCAGGACGTTGGAGGAGATGGACGCTGTGTTTGATGCCAAGTTTCCGCCGCGG
GCGGCGCTTCAGAAGCCGACTGCGTTGCAGGTGAAGGGGTCGTAG
Transcript >Ophun1|491
ATGTCATCGAGTCCTGCCGTCGAAGCTGTCGGGGAAAAGGAGGCTCGAGAAGCCATCGTCGAGGTCCAAGGCGAT
GCTCCGTTCTCCGGTTCTGCCGCCGCTGCCGCGCCTTTGGATCCCTTCTCCCGGACGAGCTTTCAGCTGTATGCC
ATCCTGCTTGTTGCGGCTCTCAACGCAACGGCCTCTGGATTCGATGGGTCCATCTTTAGTTCCATCAACGCTATG
GCGCAGTATCAAGACTACTTCAATCACAAAGAACTCGGCTCGGCCACCGGCCTCATCTTCATGATATTCACCGTT
GGGAGCATGGTCGGCTCTCTCTTCTCCGGTCCCGTCTGCGACAACTTCGGCCGCCGAATCGGCATGGCCGCCGGC
TCCGTCTTGATAATGACCGGGGCTGCCGTCCAGACAGCTGCCAGAGGCAACGCCTCGCTCCTCGCTGGCCGCTTC
GTCCTGGGCTTTGGCGTCGCCATTGGCACCTCGTCTGCTCCGACGTATGCGCTTGAACTGGCTCCGCCGCAGTGG
CGAGCACGCATTGTCGGCTACTACAATACCTTCTTCTACTCCGGGTCTATCCTGGCAACCGGAGTCGCCTACGCC
TCGAGCAGGTCTACAGGCGAGATTGCCTTCCGCCTCCCGCTATCTCTCCAGCTCGTCTTCCCCCTCTTCATCCTC
ATCGGAACCGCCTTCATCCCCGAATCGCCACGCTGGCTCACCATGTGGGGGAGAAAGGACGAAGCCGGCCGCATC
CTGGCCAAGTATCACGGAGGTGGCAATGCGAACCACCCGCTGGTCCTCCTCGAGCTGCGAGAGTTTGAAGCCAAC
ATTGAACTCCAAAAGTCTTCCAGCGTCTGGAACTACTGGTCTCTCGTGGAGACGCACAACGCTCGCTGGCGCTTT
ACCATGATGGCTTTCATGTCCATCTTTGCCCAGCTGTCGGGAAACTCGGTCCTGACGTACTATCTGCCATCCATG
TATAGGCAGGTTGGGATCACGACGACTGAGCGCCGCCTGCTTCTCACCTTTATCAACTCCATCGTGTCCTGCATC
GGGGCCATAGCCGGCTCCGCAACGAATGATCGGATGGGACGACGGTCGAAACTGTGGATTGGTAGTTTCGTCCTT
GCCGGCCTCTTGGGCGCCGTCACGGGCTTCTCCAGTCAGTTTGGCGATGCCAGCAAGAAAGTAGGGATCTTTCTC
TTCGGCTTTGCGTATTCCTATGTCTACACCCCGTTGACTAGCACCTACTGCGGCGAGGTGCTAGCGAACCCAACT
CGAGCCAAGGGAATGGGCGTGCACGTCCTCCTGGGGAACATGGCCAACCTTTACAACGCATACGTCACGGCCATC
GCGTTCGAAGCCATAGGCTGGCGCTATTACCTCGTCTTTGTCGGTCTCAACATCTTGTACGGTGTTTTGTGGTAC
GTCTTTGGCGTCGAAACTCGTGGCAGGACGTTGGAGGAGATGGACGCTGTGTTTGATGCCAAGTTTCCGCCGCGG
GCGGCGCTTCAGAAGCCGACTGCGTTGCAGGTGAAGGGGTCGTAG
Gene >Ophun1|491
ATGTCATCGAGTCCTGCCGTCGAAGCTGTCGGGGAAAAGGAGGCTCGAGAAGCCATCGTCGAGGTCCAAGGCGAT
GCTCCGTTCTCCGGTTCTGCCGCCGCTGCCGCGCCTTTGGATCCCTTCTCCCGGACGAGCTTTCAGCTGTATGCC
ATCCTGCTTGTTGCGGCTCTCAACGCAACGGCCTCTGGATTCGATGGGGTGAGTCTCACCCTTTCAACGAGAAGA
TAGGTGTTGACATTGACGGCAATAGTCCATCTTTAGTTCCATCAACGCTATGGCGCAGTATCAAGACTACTTCAA
TCACAAAGAACTCGGCTCGGCCACCGGCCTGTAAGTCTACCACTTCTCTCTACACATGGCGTCTAACAGCTCCCT
AGCATCTTCATGATATTCACCGTTGGGAGCATGGTCGGCTCTCTCTTCTCCGGTCCCGTCTGCGACAACTTCGGC
CGCCGAATCGGCATGGCCGCCGGCTCCGTCTTGATAATGACCGGGGCTGCCGTCCAGACAGCTGCCAGAGGCAAC
GCCTCGCTCCTCGCTGGCCGCTTCGTCCTGGGCTTTGGCGTCGCCATTGGCACCTCGTCTGCTCCGACGTATGCG
CTTGAACTGGCTCCGCCGCAGTGGCGAGCACGCATTGTCGGCTACTACAATACCTGTACGAAGCCTCCTCGAGAT
AGAAAGCCCCCAGACTCACTCGATACAGTCTTCTACTCCGGGTCTATCCTGGCAACCGGAGTCGCCTACGCCTCG
AGCAGGTCTACAGGCGAGATTGCCTTCCGCCTCCCGCTATCTCTCCAGCTCGTCTTCCCCCTCTTCATCCTCATC
GGAACCGCCTTCATCCCCGAATCGCCACGCTGGCTCACCATGTGGGGGAGAAAGGACGAAGCCGGCCGCATCCTG
GCCAAGTATCACGGAGGTGGCAATGCGAACCACCCGCTGGTCCTCCTCGAGCTGCGAGAGTTTGAAGCCAACATT
GAACTCCAAAAGTCTTCCAGCGTCTGGAACTACTGGTCTCTCGTGGAGACGCACAACGCTCGCTGGCGCTTTACC
ATGATGGCTTTCATGTCCATCTTTGCCCAGCTGTCGGGAAACTCGGTCCTGACGTACTATCTGCCATCCATGTAT
AGGCAGGTTGGGATCACGACGACTGAGCGCCGCCTGCTTCTCACCTTTATCAACTCCATCGTGTCCTGCATCGGG
GCCATAGCCGGCTCCGCAACGAATGATCGGATGGGACGACGGTCGAAACTGTGGATTGGTAGTTTCGTCCTTGCC
GGCCTCTTGGGCGCCGTCACGGGCTTCTCCAGTCAGTTTGGCGATGCCAGCAAGAAAGTAGGGGTTGAGATTTCC
AACAGCGGCGTGGCCTTTGTGAGAGAACCTACGATTCTTGACTTCAAGACAACAGCTAACGATTTCACGCAGATC
TTTCTCTTCGGCTTTGCGTATTCCTATGTCTACACCCCGTTGACTAGCACCTACTGCGGCGAGGTGCTAGCGAAC
CCAACTCGAGCCAAGGGAATGGGCGTGGTAAGTCAAAGTTGAAAGCCTTCTCAACCTACTGAACTCATCATCCCA
CAGCACGTCCTCCTGGGGAACATGGCCAACCTTTACAACGCATACGTCACGGCCATCGCGTTCGAAGCCATAGGC
TGGCGCTATTACCTCGTCTTTGTCGGTCTCAACATCTTGTACGGTGTTTTGTGGTACGTCTTTGGCGTCGAAACT
CGTGGCAGGACGTTGGAGGAGATGGACGCTGTGTTTGATGCCAAGTTTCCGCCGCGGGCGGCGCTTCAGAAGCCG
ACTGCGTTGCAGGTGAAGGGGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail