Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4908
Gene name
LocationContig_465:13488..14252
Strand+
Gene length (bp)764
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01201 Ribosomal_S8e Ribosomal protein S8e 5.8E-54 5 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX39|RS8A_YEAST 40S ribosomal protein S8-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS8A PE=1 SV=1 1 204 9.0E-102
sp|P0CX40|RS8B_YEAST 40S ribosomal protein S8-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS8B PE=1 SV=1 1 204 9.0E-102
sp|Q9P7B2|RS8B_SCHPO 40S ribosomal protein S8-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps802 PE=1 SV=1 1 204 6.0E-99
sp|O14049|RS8A_SCHPO 40S ribosomal protein S8-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps801 PE=3 SV=1 1 204 9.0E-98
sp|Q8WQI5|RS8_SPOFR 40S ribosomal protein S8 OS=Spodoptera frugiperda GN=RpS8 PE=2 SV=1 1 204 1.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX39|RS8A_YEAST 40S ribosomal protein S8-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS8A PE=1 SV=1 1 204 9.0E-102
sp|P0CX40|RS8B_YEAST 40S ribosomal protein S8-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS8B PE=1 SV=1 1 204 9.0E-102
sp|Q9P7B2|RS8B_SCHPO 40S ribosomal protein S8-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps802 PE=1 SV=1 1 204 6.0E-99
sp|O14049|RS8A_SCHPO 40S ribosomal protein S8-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps801 PE=3 SV=1 1 204 9.0E-98
sp|Q8WQI5|RS8_SPOFR 40S ribosomal protein S8 OS=Spodoptera frugiperda GN=RpS8 PE=2 SV=1 1 204 1.0E-78
sp|O76756|RS8_APIME 40S ribosomal protein S8 OS=Apis mellifera GN=RpS8 PE=2 SV=2 1 204 1.0E-76
sp|Q7SYU0|RS8_XENLA 40S ribosomal protein S8 OS=Xenopus laevis GN=rps8 PE=2 SV=3 1 204 4.0E-76
sp|Q8MLY8|RS8_DROME 40S ribosomal protein S8 OS=Drosophila melanogaster GN=RpS8 PE=1 SV=1 1 204 3.0E-75
sp|P62243|RS8_RAT 40S ribosomal protein S8 OS=Rattus norvegicus GN=Rps8 PE=1 SV=2 1 204 3.0E-75
sp|P62242|RS8_MOUSE 40S ribosomal protein S8 OS=Mus musculus GN=Rps8 PE=1 SV=2 1 204 3.0E-75
sp|Q4R6P8|RS8_MACFA 40S ribosomal protein S8 OS=Macaca fascicularis GN=RPS8 PE=2 SV=3 1 204 3.0E-75
sp|P62241|RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 1 204 3.0E-75
sp|Q5E958|RS8_BOVIN 40S ribosomal protein S8 OS=Bos taurus GN=RPS8 PE=2 SV=3 1 204 3.0E-75
sp|Q90YR6|RS8_ICTPU 40S ribosomal protein S8 OS=Ictalurus punctatus GN=rps8 PE=2 SV=3 1 204 5.0E-75
sp|Q08069|RS8_MAIZE 40S ribosomal protein S8 OS=Zea mays GN=RPS8 PE=2 SV=2 1 206 8.0E-75
sp|P62247|RS8_DANRE 40S ribosomal protein S8 OS=Danio rerio GN=rps8 PE=2 SV=2 1 204 1.0E-74
sp|P49199|RS8_ORYSJ 40S ribosomal protein S8 OS=Oryza sativa subsp. japonica GN=RPS8 PE=2 SV=2 1 206 2.0E-72
sp|P48156|RS8_CAEEL 40S ribosomal protein S8 OS=Caenorhabditis elegans GN=rps-8 PE=3 SV=1 1 204 7.0E-72
sp|Q9FIF3|RS82_ARATH 40S ribosomal protein S8-2 OS=Arabidopsis thaliana GN=RPS8B PE=2 SV=1 1 200 1.0E-71
sp|Q54E24|RS8_DICDI 40S ribosomal protein S8 OS=Dictyostelium discoideum GN=rps8 PE=1 SV=1 1 206 1.0E-69
sp|Q4N3P0|RS8_THEPA 40S ribosomal protein S8 OS=Theileria parva GN=RPS8 PE=3 SV=1 1 206 7.0E-68
sp|Q9ZT56|RS8_GRIJA 40S ribosomal protein S8 OS=Griffithsia japonica GN=RPS8 PE=2 SV=1 1 200 1.0E-66
sp|Q4UFS9|RS8_THEAN 40S ribosomal protein S8 OS=Theileria annulata GN=RPS8 PE=3 SV=1 1 206 5.0E-66
sp|Q93VG5|RS81_ARATH 40S ribosomal protein S8-1 OS=Arabidopsis thaliana GN=RPS8A PE=2 SV=1 1 201 3.0E-63
sp|O81361|RS8_PRUAR 40S ribosomal protein S8 OS=Prunus armeniaca GN=RPS8 PE=2 SV=1 1 206 3.0E-63
sp|P25204|RS8_LEIMA 40S ribosomal protein S8 OS=Leishmania major GN=RPS8A PE=3 SV=1 1 206 4.0E-56
sp|A0B8P7|RS8E_METTP 30S ribosomal protein S8e OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps8e PE=3 SV=1 11 105 2.0E-14
sp|A2STM4|RS8E_METLZ 30S ribosomal protein S8e OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps8e PE=3 SV=1 11 105 8.0E-12
sp|A5UNB3|RS8E_METS3 30S ribosomal protein S8e OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps8e PE=3 SV=1 1 103 1.0E-10
sp|P61301|RS8E_NANEQ 30S ribosomal protein S8e OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps8e PE=3 SV=1 8 105 4.0E-10
sp|A3CSQ2|RS8E_METMJ 30S ribosomal protein S8e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps8e PE=3 SV=1 8 105 2.0E-09
sp|A7IAR0|RS8E_METB6 30S ribosomal protein S8e OS=Methanoregula boonei (strain 6A8) GN=rps8e PE=3 SV=1 11 105 2.0E-09
sp|O26309|RS8E_METTH 30S ribosomal protein S8e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps8e PE=1 SV=1 14 110 4.0E-09
sp|Q465V4|RS8E_METBF 30S ribosomal protein S8e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps8e PE=3 SV=1 10 103 7.0E-09
sp|Q9UZL4|RS8E_PYRAB 30S ribosomal protein S8e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps8e PE=3 SV=1 8 105 8.0E-09
sp|P54055|RS8E_METJA 30S ribosomal protein S8e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps8e PE=3 SV=1 8 105 1.0E-08
sp|B8GJR4|RS8E_METPE 30S ribosomal protein S8e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps8e PE=3 SV=1 11 105 1.0E-08
sp|Q8PVC6|RS8E_METMA 30S ribosomal protein S8e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps8e PE=3 SV=1 10 110 1.0E-08
sp|Q8U1Y5|RS8E_PYRFU 30S ribosomal protein S8e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps8e PE=1 SV=1 8 105 2.0E-08
sp|O58830|RS8E_PYRHO 30S ribosomal protein S8e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps8e PE=3 SV=1 8 105 2.0E-08
sp|C5A4I6|RS8E_THEGJ 30S ribosomal protein S8e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps8e PE=3 SV=1 8 105 2.0E-08
sp|Q2FU12|RS8E_METHJ 30S ribosomal protein S8e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps8e PE=3 SV=1 8 105 2.0E-08
sp|Q5JGF3|RS8E_THEKO 30S ribosomal protein S8e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps8e PE=3 SV=1 8 105 4.0E-08
sp|Q8TS82|RS8E_METAC 30S ribosomal protein S8e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps8e PE=3 SV=1 10 110 4.0E-08
sp|Q6L0D3|RS8E_PICTO 30S ribosomal protein S8e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps8e PE=3 SV=2 8 105 1.0E-07
sp|Q12UA1|RS8E_METBU 30S ribosomal protein S8e OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps8e PE=3 SV=1 8 110 1.0E-07
sp|P49402|RS8E_HALMA 30S ribosomal protein S8e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps8e PE=1 SV=1 8 103 2.0E-07
sp|B6YTF2|RS8E_THEON 30S ribosomal protein S8e OS=Thermococcus onnurineus (strain NA1) GN=rps8e PE=3 SV=1 8 105 2.0E-07
sp|O28130|RS8E_ARCFU 30S ribosomal protein S8e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps8e PE=3 SV=1 8 102 2.0E-07
sp|Q0W1L5|RS8E_METAR 30S ribosomal protein S8e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps8e PE=3 SV=1 8 105 2.0E-07
sp|A2BK08|RS8E_HYPBU 30S ribosomal protein S8e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps8e PE=3 SV=1 1 105 6.0E-07
sp|Q9HPE9|RS8E_HALSA 30S ribosomal protein S8e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps8e PE=3 SV=1 8 110 2.0E-06
sp|B0R639|RS8E_HALS3 30S ribosomal protein S8e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps8e PE=3 SV=1 8 110 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5101
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2083
Ophiocordyceps australis map64 (Brazil) OphauB2|7485
Ophiocordyceps camponoti-floridani Ophcf2|06563
Ophiocordyceps camponoti-rufipedis Ophun1|4908 (this protein)
Ophiocordyceps kimflemingae Ophio5|817
Ophiocordyceps subramaniannii Hirsu2|3175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4908
MGISRDSRHKRSASGAKRAFYRKKRAFEAGRQGANTRIGPKRIHTVRTRGGNHKYRALRLDSGNFAWASEGCTRK
TRVIAVAYHPSNNELVRTNTLTRSAVVQVDAAPFRQWYEAHYGQSLGRRRQKAQAAKEGKVEEETKKSKSVEKKQ
AARYAASGKVEAPLEKQFEAGRLYAIISSRPGQSGRCDGYILEGDELAFYQRKLHK*
Coding >Ophun1|4908
ATGGGTATCTCTCGCGACTCCCGCCATAAGCGCTCCGCGTCCGGCGCCAAACGCGCCTTCTACCGGAAGAAGCGA
GCTTTCGAGGCCGGCCGCCAGGGCGCCAACACGCGTATCGGCCCCAAGCGCATCCATACCGTCCGCACCCGCGGC
GGAAACCACAAGTACCGCGCCCTGCGTCTCGACTCGGGCAACTTCGCCTGGGCCTCTGAGGGTTGCACCCGAAAG
ACGCGCGTCATCGCCGTCGCCTACCACCCTTCCAACAACGAGCTCGTCCGCACCAACACCTTGACCCGCAGCGCC
GTCGTCCAGGTCGACGCCGCGCCCTTCCGCCAATGGTACGAGGCTCACTACGGTCAGTCTCTTGGCCGCAGACGT
CAGAAGGCCCAGGCCGCCAAGGAGGGAAAGGTCGAGGAGGAGACCAAGAAGAGCAAGTCGGTCGAGAAGAAGCAG
GCTGCCAGGTACGCCGCCTCGGGCAAGGTCGAGGCCCCGCTGGAGAAGCAGTTCGAGGCTGGTCGCCTGTACGCC
ATCATTTCCAGCCGGCCCGGTCAGTCCGGCCGCTGCGACGGCTACATCCTCGAGGGCGATGAGCTCGCCTTTTAC
CAGCGCAAGCTGCACAAGTGA
Transcript >Ophun1|4908
ATGGGTATCTCTCGCGACTCCCGCCATAAGCGCTCCGCGTCCGGCGCCAAACGCGCCTTCTACCGGAAGAAGCGA
GCTTTCGAGGCCGGCCGCCAGGGCGCCAACACGCGTATCGGCCCCAAGCGCATCCATACCGTCCGCACCCGCGGC
GGAAACCACAAGTACCGCGCCCTGCGTCTCGACTCGGGCAACTTCGCCTGGGCCTCTGAGGGTTGCACCCGAAAG
ACGCGCGTCATCGCCGTCGCCTACCACCCTTCCAACAACGAGCTCGTCCGCACCAACACCTTGACCCGCAGCGCC
GTCGTCCAGGTCGACGCCGCGCCCTTCCGCCAATGGTACGAGGCTCACTACGGTCAGTCTCTTGGCCGCAGACGT
CAGAAGGCCCAGGCCGCCAAGGAGGGAAAGGTCGAGGAGGAGACCAAGAAGAGCAAGTCGGTCGAGAAGAAGCAG
GCTGCCAGGTACGCCGCCTCGGGCAAGGTCGAGGCCCCGCTGGAGAAGCAGTTCGAGGCTGGTCGCCTGTACGCC
ATCATTTCCAGCCGGCCCGGTCAGTCCGGCCGCTGCGACGGCTACATCCTCGAGGGCGATGAGCTCGCCTTTTAC
CAGCGCAAGCTGCACAAGTGA
Gene >Ophun1|4908
ATGGGTATCTCTCGCGACTCCCGCCATAAGCGCTCCGCGTCCGGCGCCAAACGCGCCTTCTACCGTGCGTGACCG
AACATCCGAAGCCTCTCGAAAGCCCGTATGCAATCTCTCCTCTCTACTTCTCTTCCCACCCTTTTCTTCCCCAAA
GGGAGGGTCGCAGAGGAGAGAGGAGGTGAGGAGCATGCGTTCTGACCTCGTCCGCAGGGAAGAAGCGAGCTTTCG
AGGCCGGCCGCCAGGGCGCCAACACGCGTATCGGCCCCAAGCGCATCCATACCGTCCGCACCCGCGGCGGAAACC
ACAAGTACCGCGCCCTGCGTCTCGACTCGGGCAACTTCGCCTGGGCCTCTGAGGGTTGCACCCGAAAGACGCGCG
TCATCGCCGTCGCCTACCACCCTTCCAACAACGAGCTCGTCCGCACCAACACCTTGACCCGCAGCGCCGTCGTCC
AGGTCGACGCCGCGCCCTTCCGCCAATGGTACGAGGCTCACTACGGTCAGTCTCTTGGCCGCAGACGTCAGAAGG
CCCAGGCCGCCAAGGAGGGAAAGGTCGAGGAGGAGACCAAGAAGAGCAAGTCGGTCGAGAAGAAGCAGGCTGCCA
GGTACGCCGCCTCGGGCAAGGTCGAGGCCCCGCTGGAGAAGCAGTTCGAGGCTGGTCGCCTGTACGCCATCATTT
CCAGCCGGCCCGGTCAGTCCGGCCGCTGCGACGGCTACATCCTCGAGGGCGATGAGCTCGCCTTTTACCAGCGCA
AGCTGCACAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail