Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4904
Gene name
LocationContig_465:7423..8392
Strand-
Gene length (bp)969
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 5.0E-28 150 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55C17|TECR_DICDI Very-long-chain enoyl-CoA reductase OS=Dictyostelium discoideum GN=gpsn2 PE=3 SV=1 74 300 5.0E-56
sp|O94511|YN67_SCHPO Putative enoyl reductase C646.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.07c PE=3 SV=1 5 300 6.0E-56
sp|Q9NZ01|TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens GN=TECR PE=1 SV=1 24 300 1.0E-44
sp|Q3ZCD7|TECR_BOVIN Very-long-chain enoyl-CoA reductase OS=Bos taurus GN=TECR PE=2 SV=1 24 300 2.0E-44
sp|Q64232|TECR_RAT Very-long-chain enoyl-CoA reductase OS=Rattus norvegicus GN=Tecr PE=1 SV=1 24 300 6.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55C17|TECR_DICDI Very-long-chain enoyl-CoA reductase OS=Dictyostelium discoideum GN=gpsn2 PE=3 SV=1 74 300 5.0E-56
sp|O94511|YN67_SCHPO Putative enoyl reductase C646.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.07c PE=3 SV=1 5 300 6.0E-56
sp|Q9NZ01|TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens GN=TECR PE=1 SV=1 24 300 1.0E-44
sp|Q3ZCD7|TECR_BOVIN Very-long-chain enoyl-CoA reductase OS=Bos taurus GN=TECR PE=2 SV=1 24 300 2.0E-44
sp|Q64232|TECR_RAT Very-long-chain enoyl-CoA reductase OS=Rattus norvegicus GN=Tecr PE=1 SV=1 24 300 6.0E-44
sp|Q9CY27|TECR_MOUSE Very-long-chain enoyl-CoA reductase OS=Mus musculus GN=Tecr PE=1 SV=1 24 300 9.0E-44
sp|Q9N5Y2|TECR_CAEEL Probable very-long-chain enoyl-CoA reductase art-1 OS=Caenorhabditis elegans GN=art-1 PE=3 SV=1 35 300 2.0E-40
sp|Q99190|TECR_YEAST Very-long-chain enoyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC13 PE=1 SV=1 76 281 5.0E-37
sp|Q9M2U2|TECR_ARATH Very-long-chain enoyl-CoA reductase OS=Arabidopsis thaliana GN=ECR PE=1 SV=1 5 300 1.0E-36
sp|Q8BFZ1|TECRL_MOUSE Trans-2,3-enoyl-CoA reductase-like OS=Mus musculus GN=Tecrl PE=1 SV=1 24 300 4.0E-34
sp|Q5HYJ1|TECRL_HUMAN Trans-2,3-enoyl-CoA reductase-like OS=Homo sapiens GN=TECRL PE=2 SV=1 24 300 3.0E-33
sp|Q3SZ89|TECRL_BOVIN Trans-2,3-enoyl-CoA reductase-like OS=Bos taurus GN=TECRL PE=2 SV=1 24 300 1.0E-29
sp|Q2QDF6|DET2_GOSHI Steroid 5-alpha-reductase DET2 OS=Gossypium hirsutum GN=DET2 PE=1 SV=1 194 297 1.0E-07
sp|Q38944|DET2_ARATH Steroid 5-alpha-reductase DET2 OS=Arabidopsis thaliana GN=DET2 PE=1 SV=2 192 297 1.0E-06
sp|Q9CAH5|POED1_ARATH Polyprenol reductase 1 OS=Arabidopsis thaliana GN=At1g72590 PE=3 SV=1 189 297 2.0E-06
sp|Q5K2N1|DET2_SOLLC Steroid 5-alpha-reductase DET2 OS=Solanum lycopersicum GN=DET2 PE=1 SV=1 212 299 2.0E-06
sp|Q68FF9|S5A1_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Mus musculus GN=Srd5a1 PE=2 SV=2 127 300 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 90 109 19
2 160 177 17
3 190 212 22
4 227 249 22
5 256 273 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4904
MATALKLTNRSPREPVARLPPSIQVPAGATVEDAKAIIARGCGLGDASRVGLFDPATKKTLKDRKARVADALPDG
EVLVKDLGPQVAWRTVFLVEYLGPILIHVGFVALRPRLYSEPMSSTQWLSFAMIVGHFVKRELETLLVHKFSAST
MPVFNIFKNSFFYWGLSGLLCAWSVYNPRSMAARANTPALDALGTALFLFGEAGNGLVHLYLSSLRSSGGTERKI
PAGYGFSLVTCPNYMFEILSWLGVIVASRDWAVTLFIGIGAAQMYAWARGKESAYRKEFGDKYKKKRFVMLPGLL
*
Coding >Ophun1|4904
ATGGCCACCGCTCTCAAGCTCACCAACCGCTCCCCAAGGGAGCCCGTGGCCCGGCTGCCCCCCTCGATCCAAGTC
CCCGCCGGGGCAACGGTAGAAGATGCCAAGGCCATCATCGCCCGTGGCTGCGGCCTGGGAGATGCCAGTCGCGTG
GGCCTCTTCGACCCGGCGACTAAGAAGACGCTCAAGGACCGCAAGGCGCGCGTGGCCGATGCGCTCCCGGATGGC
GAGGTGCTCGTCAAGGACCTCGGGCCGCAGGTAGCATGGAGGACCGTCTTCCTGGTCGAATACCTAGGCCCGATA
TTGATTCACGTCGGGTTCGTCGCCTTGAGACCTCGTCTTTACTCGGAACCCATGTCGTCGACGCAATGGCTCAGC
TTCGCCATGATCGTCGGCCACTTCGTCAAGCGCGAGCTCGAAACGCTCTTGGTCCACAAATTCTCCGCCAGCACC
ATGCCCGTCTTCAACATCTTCAAGAACAGCTTCTTCTACTGGGGTCTTTCCGGTCTTTTGTGCGCTTGGTCCGTC
TACAACCCGCGCTCCATGGCAGCTCGCGCCAACACGCCCGCCCTCGACGCCCTCGGCACCGCTCTCTTCCTCTTT
GGCGAGGCGGGCAATGGTCTGGTGCACCTGTACCTCTCGTCGTTGCGCTCCAGCGGCGGCACGGAGCGTAAGATT
CCCGCCGGATATGGCTTCAGCCTCGTCACCTGTCCCAACTACATGTTTGAGATTCTTTCGTGGCTGGGCGTCATC
GTCGCCAGCCGCGACTGGGCCGTTACGCTCTTTATCGGCATCGGCGCCGCCCAGATGTACGCCTGGGCCCGTGGC
AAGGAGAGCGCGTACCGCAAGGAGTTTGGCGATAAGTACAAGAAGAAGCGCTTCGTAATGCTGCCGGGTCTGCTG
TGA
Transcript >Ophun1|4904
ATGGCCACCGCTCTCAAGCTCACCAACCGCTCCCCAAGGGAGCCCGTGGCCCGGCTGCCCCCCTCGATCCAAGTC
CCCGCCGGGGCAACGGTAGAAGATGCCAAGGCCATCATCGCCCGTGGCTGCGGCCTGGGAGATGCCAGTCGCGTG
GGCCTCTTCGACCCGGCGACTAAGAAGACGCTCAAGGACCGCAAGGCGCGCGTGGCCGATGCGCTCCCGGATGGC
GAGGTGCTCGTCAAGGACCTCGGGCCGCAGGTAGCATGGAGGACCGTCTTCCTGGTCGAATACCTAGGCCCGATA
TTGATTCACGTCGGGTTCGTCGCCTTGAGACCTCGTCTTTACTCGGAACCCATGTCGTCGACGCAATGGCTCAGC
TTCGCCATGATCGTCGGCCACTTCGTCAAGCGCGAGCTCGAAACGCTCTTGGTCCACAAATTCTCCGCCAGCACC
ATGCCCGTCTTCAACATCTTCAAGAACAGCTTCTTCTACTGGGGTCTTTCCGGTCTTTTGTGCGCTTGGTCCGTC
TACAACCCGCGCTCCATGGCAGCTCGCGCCAACACGCCCGCCCTCGACGCCCTCGGCACCGCTCTCTTCCTCTTT
GGCGAGGCGGGCAATGGTCTGGTGCACCTGTACCTCTCGTCGTTGCGCTCCAGCGGCGGCACGGAGCGTAAGATT
CCCGCCGGATATGGCTTCAGCCTCGTCACCTGTCCCAACTACATGTTTGAGATTCTTTCGTGGCTGGGCGTCATC
GTCGCCAGCCGCGACTGGGCCGTTACGCTCTTTATCGGCATCGGCGCCGCCCAGATGTACGCCTGGGCCCGTGGC
AAGGAGAGCGCGTACCGCAAGGAGTTTGGCGATAAGTACAAGAAGAAGCGCTTCGTAATGCTGCCGGGTCTGCTG
TGA
Gene >Ophun1|4904
ATGGCCACCGCTCTCAAGCTCACCAACCGCTGTAATCCCCCCCCCCCCAAACCTCTATTTCCCTCCATCTCCTCT
CCGCTAACAAACCGGCCACCAGCCCCAAGGGAGCCCGTGGCCCGGCTGCCCCCCTCGATCCAAGTCCCCGCCGGG
GCAACGGTAGAAGATGCCAAGGCCATCATCGCCCGTGGCTGCGGCCTGGGAGATGCCAGTCGCGTGGGCCTCTTC
GACCCGGCGACTAAGAAGACGCTCAAGGACCGCAAGGCGCGCGTGGCCGATGCGCTCCCGGATGGCGAGGTGCTC
GTCAAGGACCTCGGGCCGCAGGTAGCATGGAGGACCGTCTTCCTGGTCGAATACCTAGGCCCGATATTGATTCAC
GTCGGGTTCGTCGCCTTGAGACCTCGTCTTTACTCGGAACCCATGTCGTCGACGCAATGGCTCAGCTTCGCCATG
ATCGTCGGCCACTTCGTCAAGCGCGAGCTCGAAACGCTCTTGGTCCACAAATTCTCCGCCAGCACCATGCCCGTC
TTCAACATCTTCAAGAACAGCTTCTTCTACTGGGGTCTTTCCGGTCTTTTGTGCGCTTGGTCCGTCTACAACCCG
CGCTCCATGGCAGCTCGCGCCAACACGCCCGCCCTCGACGCCCTCGGCACCGCTCTCTTCCTCTTTGGCGAGGCG
GGCAATGGTCTGGTGCACCTGTACCTCTCGTCGTTGCGCTCCAGCGGCGGCACGGAGCGTAAGATTCCCGCCGGA
TATGGCTTCAGCCTCGTCACCTGTCCCAACTACATGTTTGAGATTCTTTCGTGGCTGGGCGTCATCGTCGCCAGC
CGCGACTGGGCCGTTACGCTCTTTATCGGCATCGGCGCCGCCCAGATGTACGCCTGGGCCCGTGGCAAGGAGAGC
GCGTACCGCAAGGAGTTTGGCGATAAGTACAAGAAGAAGCGCTTCGTAATGCTGCCGGGTCTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail