Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4902
Gene name
LocationContig_465:3120..6106
Strand+
Gene length (bp)2986
Transcript length (bp)2880
Coding sequence length (bp)2880
Protein length (aa) 960

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10428 SOG2 RAM signalling pathway protein 9.1E-52 445 620
PF10428 SOG2 RAM signalling pathway protein 4.4E-25 657 832
PF13855 LRR_8 Leucine rich repeat 5.3E-08 178 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94294|SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sog2 PE=1 SV=1 99 288 8.0E-29
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 107 273 7.0E-17
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 110 243 7.0E-16
sp|A6NIK2|LR10B_HUMAN Leucine-rich repeat-containing protein 10B OS=Homo sapiens GN=LRRC10B PE=4 SV=2 113 244 2.0E-14
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 110 237 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94294|SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sog2 PE=1 SV=1 99 288 8.0E-29
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 107 273 7.0E-17
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 110 243 7.0E-16
sp|A6NIK2|LR10B_HUMAN Leucine-rich repeat-containing protein 10B OS=Homo sapiens GN=LRRC10B PE=4 SV=2 113 244 2.0E-14
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 110 237 3.0E-14
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 105 233 3.0E-14
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 110 243 8.0E-14
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 110 243 8.0E-14
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 111 235 1.0E-13
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 104 278 3.0E-13
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 104 278 3.0E-13
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 111 242 9.0E-13
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 99 242 1.0E-12
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 104 278 1.0E-12
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 97 244 2.0E-12
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 106 242 3.0E-12
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 100 235 4.0E-12
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 133 224 4.0E-12
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 113 242 4.0E-12
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 111 233 6.0E-12
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 104 239 6.0E-12
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 111 244 6.0E-12
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 61 244 6.0E-12
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 136 242 7.0E-12
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 111 246 8.0E-12
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 113 242 9.0E-12
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 105 242 1.0E-11
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 70 242 1.0E-11
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 100 235 1.0E-11
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 113 242 1.0E-11
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 113 242 1.0E-11
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 116 241 1.0E-11
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 109 243 1.0E-11
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 113 242 2.0E-11
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 24 242 2.0E-11
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 113 242 2.0E-11
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 111 242 2.0E-11
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 93 244 2.0E-11
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 73 262 2.0E-11
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 116 241 2.0E-11
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 113 242 2.0E-11
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 91 247 2.0E-11
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 112 242 3.0E-11
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 118 242 3.0E-11
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 109 239 3.0E-11
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 111 242 3.0E-11
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 110 236 4.0E-11
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 99 242 4.0E-11
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 136 242 4.0E-11
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 113 242 4.0E-11
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 111 244 4.0E-11
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 111 243 6.0E-11
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 101 233 7.0E-11
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 106 243 7.0E-11
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 104 244 7.0E-11
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 107 244 8.0E-11
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 111 247 9.0E-11
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 106 246 1.0E-10
sp|Q8SU52|CCR4_ENCCU Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCR4 PE=3 SV=1 136 256 1.0E-10
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 113 242 1.0E-10
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 91 247 1.0E-10
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 113 242 1.0E-10
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 113 242 1.0E-10
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 113 242 1.0E-10
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 111 242 2.0E-10
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 104 234 2.0E-10
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 87 240 2.0E-10
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 116 239 2.0E-10
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 111 242 2.0E-10
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 105 239 2.0E-10
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 106 242 2.0E-10
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 105 239 2.0E-10
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 112 244 2.0E-10
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 111 242 2.0E-10
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 106 242 3.0E-10
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 123 242 3.0E-10
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 106 301 3.0E-10
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 106 242 3.0E-10
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 92 242 4.0E-10
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 92 242 4.0E-10
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 113 242 4.0E-10
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 111 242 4.0E-10
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 118 242 4.0E-10
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 133 243 5.0E-10
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 105 242 5.0E-10
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 88 242 5.0E-10
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 105 239 5.0E-10
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 105 239 5.0E-10
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 106 242 5.0E-10
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 113 247 6.0E-10
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 92 242 7.0E-10
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 111 227 7.0E-10
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 133 243 7.0E-10
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 118 242 7.0E-10
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 92 242 8.0E-10
sp|Q8CI70|LRC20_MOUSE Leucine-rich repeat-containing protein 20 OS=Mus musculus GN=Lrrc20 PE=1 SV=1 110 236 8.0E-10
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 113 242 8.0E-10
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 111 242 8.0E-10
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 92 242 9.0E-10
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 113 218 9.0E-10
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 133 242 1.0E-09
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 79 242 1.0E-09
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 133 243 1.0E-09
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 111 258 1.0E-09
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 100 243 1.0E-09
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 133 244 1.0E-09
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 133 254 1.0E-09
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 87 240 1.0E-09
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 87 270 1.0E-09
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 133 216 1.0E-09
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 87 240 1.0E-09
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 87 240 1.0E-09
sp|Q96L50|LLR1_HUMAN Leucine-rich repeat protein 1 OS=Homo sapiens GN=LRR1 PE=1 SV=2 133 241 1.0E-09
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 96 233 2.0E-09
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 100 240 2.0E-09
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 111 257 2.0E-09
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 110 233 2.0E-09
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 100 280 2.0E-09
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 102 242 2.0E-09
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 111 243 2.0E-09
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 72 242 2.0E-09
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 113 240 2.0E-09
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 119 242 2.0E-09
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 104 242 2.0E-09
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 118 242 2.0E-09
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 111 247 2.0E-09
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 111 239 2.0E-09
sp|Q2UUI3|CCR4_ASPOR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ccr4 PE=3 SV=1 143 246 2.0E-09
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 106 242 3.0E-09
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 79 242 3.0E-09
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 92 242 3.0E-09
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 88 288 3.0E-09
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 78 247 3.0E-09
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 113 242 3.0E-09
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 110 238 3.0E-09
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 109 243 3.0E-09
sp|Q6FRT2|CCR4_CANGA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCR4 PE=3 SV=1 136 244 3.0E-09
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 111 238 3.0E-09
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 88 247 4.0E-09
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 92 242 4.0E-09
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 104 242 4.0E-09
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 113 242 4.0E-09
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 87 240 4.0E-09
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 111 239 4.0E-09
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 143 246 4.0E-09
sp|Q8TCA0|LRC20_HUMAN Leucine-rich repeat-containing protein 20 OS=Homo sapiens GN=LRRC20 PE=1 SV=1 110 236 4.0E-09
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 111 243 4.0E-09
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 105 241 5.0E-09
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 133 239 5.0E-09
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 133 224 5.0E-09
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 92 242 5.0E-09
sp|P31384|CCR4_YEAST Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCR4 PE=1 SV=2 136 235 5.0E-09
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 133 235 5.0E-09
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 113 240 5.0E-09
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 133 228 6.0E-09
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 132 244 6.0E-09
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 96 242 6.0E-09
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 136 244 6.0E-09
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 100 240 7.0E-09
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 105 244 7.0E-09
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 102 242 7.0E-09
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 91 247 8.0E-09
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 133 239 8.0E-09
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 102 242 8.0E-09
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 109 247 9.0E-09
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 126 246 9.0E-09
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 55 242 1.0E-08
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 110 239 1.0E-08
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 39 225 1.0E-08
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 88 225 1.0E-08
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 102 242 1.0E-08
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 102 242 1.0E-08
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 102 242 1.0E-08
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 132 229 1.0E-08
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 111 247 1.0E-08
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 102 242 1.0E-08
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 135 242 1.0E-08
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 107 244 1.0E-08
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 110 244 1.0E-08
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 133 216 1.0E-08
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 110 242 1.0E-08
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 107 233 1.0E-08
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 110 244 1.0E-08
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 133 236 1.0E-08
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 143 246 1.0E-08
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 110 244 1.0E-08
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 93 260 1.0E-08
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 110 236 2.0E-08
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 104 246 2.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 123 242 2.0E-08
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 99 247 2.0E-08
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 132 246 2.0E-08
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 133 242 2.0E-08
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 104 235 2.0E-08
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 88 288 2.0E-08
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 88 267 2.0E-08
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 105 217 2.0E-08
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 87 240 2.0E-08
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 105 242 2.0E-08
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 104 242 2.0E-08
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 64 230 2.0E-08
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 111 244 2.0E-08
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 109 242 2.0E-08
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 105 242 2.0E-08
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 110 244 2.0E-08
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 139 244 2.0E-08
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 111 233 2.0E-08
sp|Q9C2R2|CCR4_NEUCR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccr4 PE=3 SV=2 34 236 2.0E-08
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 109 234 3.0E-08
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 109 234 3.0E-08
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 102 242 3.0E-08
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 78 246 3.0E-08
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 109 233 3.0E-08
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 105 217 3.0E-08
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 66 242 3.0E-08
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 113 244 3.0E-08
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 113 244 3.0E-08
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 104 223 3.0E-08
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 97 244 3.0E-08
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 117 243 3.0E-08
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 133 242 3.0E-08
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 109 234 4.0E-08
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 132 220 4.0E-08
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 118 235 4.0E-08
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 87 242 4.0E-08
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 109 240 4.0E-08
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 102 242 4.0E-08
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 105 242 4.0E-08
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 105 242 4.0E-08
sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 133 243 5.0E-08
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 106 242 5.0E-08
sp|Q9ULM6|CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens GN=CNOT6 PE=1 SV=2 123 243 5.0E-08
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 133 247 6.0E-08
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 111 240 6.0E-08
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 109 234 6.0E-08
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 132 240 6.0E-08
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 109 234 6.0E-08
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 107 234 6.0E-08
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 109 233 6.0E-08
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 105 242 6.0E-08
sp|C4V7I7|CCR4_NOSCE Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Nosema ceranae (strain BRL01) GN=CCR4 PE=3 SV=1 136 268 6.0E-08
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 136 239 6.0E-08
sp|Q6CJU4|CCR4_KLULA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCR4 PE=3 SV=1 136 235 6.0E-08
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 88 220 7.0E-08
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 109 234 7.0E-08
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 109 234 7.0E-08
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 88 242 7.0E-08
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 106 216 7.0E-08
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 106 242 7.0E-08
sp|Q8VEG6|CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus GN=Cnot6l PE=1 SV=2 123 236 7.0E-08
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 88 247 8.0E-08
sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1 132 233 8.0E-08
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 87 242 8.0E-08
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 109 234 9.0E-08
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 111 239 9.0E-08
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 111 239 9.0E-08
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 106 242 9.0E-08
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 96 233 9.0E-08
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 111 240 9.0E-08
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 106 240 9.0E-08
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 109 234 1.0E-07
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 105 242 1.0E-07
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 111 228 1.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 137 242 1.0E-07
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 132 246 1.0E-07
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 132 242 1.0E-07
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 109 234 1.0E-07
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 111 270 1.0E-07
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 92 242 1.0E-07
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 111 235 1.0E-07
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 110 239 1.0E-07
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 111 241 1.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 111 242 1.0E-07
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 111 242 1.0E-07
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 89 228 1.0E-07
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 87 235 1.0E-07
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 132 240 1.0E-07
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 111 240 1.0E-07
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 131 235 1.0E-07
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 111 242 2.0E-07
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 87 244 2.0E-07
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 47 243 2.0E-07
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 93 233 2.0E-07
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 131 232 2.0E-07
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 116 247 2.0E-07
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 111 242 2.0E-07
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 109 244 2.0E-07
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 109 244 2.0E-07
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 136 244 2.0E-07
sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47 OS=Mus musculus GN=Lrrc47 PE=1 SV=1 132 233 2.0E-07
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 154 243 2.0E-07
sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 OS=Mus musculus GN=Cnot6 PE=1 SV=2 154 243 2.0E-07
sp|Q0U7W4|CCR4_PHANO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CCR4 PE=3 SV=2 147 246 2.0E-07
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 133 239 2.0E-07
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=1 SV=1 154 243 2.0E-07
sp|Q5A761|CCR4_CANAL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCR4 PE=3 SV=1 135 235 2.0E-07
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 445 584 3.0E-07
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 133 235 3.0E-07
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 133 242 3.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 73 242 3.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 107 234 3.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 73 242 3.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 107 234 3.0E-07
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 111 242 3.0E-07
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 107 234 3.0E-07
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 71 242 3.0E-07
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 107 234 3.0E-07
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 111 235 3.0E-07
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 111 235 3.0E-07
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 107 234 3.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 113 237 3.0E-07
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 105 242 3.0E-07
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 105 233 3.0E-07
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 111 237 3.0E-07
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 143 244 3.0E-07
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 133 242 3.0E-07
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 113 236 3.0E-07
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 109 242 3.0E-07
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 111 242 3.0E-07
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 93 233 3.0E-07
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 110 234 4.0E-07
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 110 239 4.0E-07
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 111 235 4.0E-07
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 113 239 4.0E-07
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 37 242 4.0E-07
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 111 241 4.0E-07
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 111 242 4.0E-07
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 111 242 4.0E-07
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 132 233 4.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 132 322 4.0E-07
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 111 242 4.0E-07
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 111 236 4.0E-07
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 93 311 4.0E-07
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 125 244 4.0E-07
sp|Q4WQG5|CCR4_ASPFU Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccr4 PE=3 SV=1 143 244 4.0E-07
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 110 218 5.0E-07
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 111 228 5.0E-07
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 103 242 5.0E-07
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 102 242 5.0E-07
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 109 242 5.0E-07
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 133 242 5.0E-07
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 111 241 5.0E-07
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 88 398 6.0E-07
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 111 239 6.0E-07
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 87 244 6.0E-07
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 133 241 6.0E-07
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 87 244 6.0E-07
sp|A1CIJ6|CCR4_ASPCL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccr4 PE=3 SV=1 143 244 6.0E-07
sp|Q6XHB2|ROCO4_DICDI Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum GN=roco4 PE=1 SV=1 101 210 6.0E-07
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 111 238 7.0E-07
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 105 232 7.0E-07
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 92 243 7.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 107 234 7.0E-07
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 36 243 7.0E-07
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 111 216 7.0E-07
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 109 242 7.0E-07
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 101 253 7.0E-07
sp|Q05C16|LRC63_HUMAN Leucine-rich repeat-containing protein 63 OS=Homo sapiens GN=LRRC63 PE=2 SV=2 132 244 7.0E-07
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 87 243 8.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 86 235 8.0E-07
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 99 242 8.0E-07
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 44 242 8.0E-07
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 93 223 8.0E-07
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 111 246 8.0E-07
sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 133 228 8.0E-07
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 87 235 9.0E-07
sp|A6H694|LRC63_MOUSE Leucine-rich repeat-containing protein 63 OS=Mus musculus GN=Lrrc63 PE=2 SV=1 129 239 9.0E-07
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 64 238 1.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 136 242 1.0E-06
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 129 242 1.0E-06
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 131 242 1.0E-06
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 90 243 1.0E-06
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 132 247 1.0E-06
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 111 242 1.0E-06
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 133 241 1.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 109 233 1.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 82 233 1.0E-06
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 105 242 1.0E-06
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 123 242 1.0E-06
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 111 244 1.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 111 237 1.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 99 215 1.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 105 233 1.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 105 242 1.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 71 243 1.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 111 243 1.0E-06
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 132 219 1.0E-06
sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 OS=Mus musculus GN=Cnot6 PE=1 SV=2 132 219 1.0E-06
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=1 SV=1 132 219 1.0E-06
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 104 216 1.0E-06
sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-like OS=Danio rerio GN=cnot6l PE=2 SV=1 123 243 1.0E-06
sp|Q6XHA5|ROC11_DICDI Probable serine/threonine-protein kinase roco11 OS=Dictyostelium discoideum GN=roco11 PE=3 SV=1 136 235 1.0E-06
sp|B7XK66|CCR4_ENTBH Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Enterocytozoon bieneusi (strain H348) GN=CCR4 PE=3 SV=1 126 253 1.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 133 244 1.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 110 258 2.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 111 239 2.0E-06
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 85 242 2.0E-06
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 88 242 2.0E-06
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 111 227 2.0E-06
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 73 242 2.0E-06
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 105 310 2.0E-06
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 118 239 2.0E-06
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 73 242 2.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 87 282 2.0E-06
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 111 242 2.0E-06
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 133 243 2.0E-06
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 111 235 2.0E-06
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 99 233 2.0E-06
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 76 240 2.0E-06
sp|Q6NWG1|LRC59_DANRE Leucine-rich repeat-containing protein 59 OS=Danio rerio GN=lrrc59 PE=2 SV=1 126 235 2.0E-06
sp|Q9LUL4|SRF7_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsis thaliana GN=SRF7 PE=1 SV=1 133 212 2.0E-06
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 108 213 2.0E-06
sp|Q6BMM5|CCR4_DEBHA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCR4 PE=3 SV=2 135 235 2.0E-06
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 132 235 2.0E-06
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 109 238 3.0E-06
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 109 238 3.0E-06
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 104 247 3.0E-06
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 111 242 3.0E-06
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 111 240 3.0E-06
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 53 243 3.0E-06
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 109 249 3.0E-06
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 105 242 3.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 132 233 3.0E-06
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 124 222 3.0E-06
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 82 233 3.0E-06
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 133 244 3.0E-06
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 111 242 3.0E-06
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 82 233 3.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 111 235 3.0E-06
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 138 242 3.0E-06
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 129 235 3.0E-06
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 64 221 3.0E-06
sp|Q6CEJ6|CCR4_YARLI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCR4 PE=3 SV=1 63 243 3.0E-06
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 111 233 4.0E-06
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 88 243 4.0E-06
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 138 242 4.0E-06
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 133 254 4.0E-06
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 109 242 4.0E-06
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 105 242 4.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 76 247 4.0E-06
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 93 233 4.0E-06
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 104 216 4.0E-06
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 109 242 4.0E-06
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 104 290 5.0E-06
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 105 232 5.0E-06
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 105 232 5.0E-06
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 105 232 5.0E-06
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 109 242 5.0E-06
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 133 239 5.0E-06
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 105 232 5.0E-06
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 105 232 5.0E-06
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 113 242 5.0E-06
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 113 242 5.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 111 242 5.0E-06
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 133 210 5.0E-06
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 126 289 5.0E-06
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 111 236 5.0E-06
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 104 233 5.0E-06
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 64 221 5.0E-06
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 157 247 6.0E-06
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 87 243 6.0E-06
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 133 235 6.0E-06
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 88 247 6.0E-06
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 115 243 6.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 114 270 6.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 80 242 6.0E-06
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 87 216 6.0E-06
sp|Q9BGP6|LRRT3_MACFA Leucine-rich repeat transmembrane neuronal protein 3 OS=Macaca fascicularis GN=LRRTM3 PE=2 SV=1 133 236 6.0E-06
sp|Q86VH5|LRRT3_HUMAN Leucine-rich repeat transmembrane neuronal protein 3 OS=Homo sapiens GN=LRRTM3 PE=2 SV=2 133 236 6.0E-06
sp|Q66HD6|LRC18_RAT Leucine-rich repeat-containing protein 18 OS=Rattus norvegicus GN=Lrrc18 PE=2 SV=1 111 241 6.0E-06
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 64 221 6.0E-06
sp|Q8BZ81|LRRT3_MOUSE Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus GN=Lrrtm3 PE=2 SV=2 133 236 6.0E-06
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 100 235 7.0E-06
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 157 247 7.0E-06
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 87 243 7.0E-06
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 135 242 7.0E-06
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 135 242 7.0E-06
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 135 242 7.0E-06
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 135 242 7.0E-06
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 132 233 7.0E-06
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 99 276 7.0E-06
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 99 215 7.0E-06
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 127 228 7.0E-06
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 133 242 7.0E-06
sp|Q5E9X4|LRC59_BOVIN Leucine-rich repeat-containing protein 59 OS=Bos taurus GN=LRRC59 PE=2 SV=1 129 235 7.0E-06
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 98 242 8.0E-06
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 98 242 8.0E-06
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 110 242 8.0E-06
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 133 235 8.0E-06
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 136 244 8.0E-06
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 71 243 8.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 110 242 8.0E-06
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 106 239 8.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 64 226 8.0E-06
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 118 223 8.0E-06
sp|D3ZAL8|LRRT3_RAT Leucine-rich repeat transmembrane neuronal protein 3 OS=Rattus norvegicus GN=Lrrtm3 PE=3 SV=1 133 236 8.0E-06
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 132 241 8.0E-06
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 110 241 8.0E-06
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 98 242 9.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 110 242 9.0E-06
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 111 239 9.0E-06
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 127 228 9.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 82 233 9.0E-06
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 106 239 9.0E-06
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 109 243 9.0E-06
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 111 244 9.0E-06
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 87 246 1.0E-05
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 111 243 1.0E-05
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 111 239 1.0E-05
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 111 243 1.0E-05
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 114 241 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4902
MDRLDRMPGPASQPSGVRGLPDNPAQGRRAVGPPYPTMSNGHPPPPPPPAHSKSGPRKAPSNANLSASKVMTPAQ
VMALAQQAMQNALESEKNQAADVDAVGPGLRSGVTIDLSRKDIQRLPEEVVDIVKDELERLALSHNQLTSLPARF
SECTLLRYLNIRGNQIKEFPMPLCDLKSLEILDLGRNQLRSLPNELSKLSSLKVLSVPKNQIRELPVCLADMVSL
QVLKFEGNPVSFPPKDVLRPQNGSPPNDGFPRETDVNEVTMTAYIKKYMKQYAILGRTDPEATGDESSEGAETPR
FPLKRAASGRFPIKVNGADVPDIRSPNSGSRPPIVPIRAHSRGLSQQNAATRRPNVMPLTIGNVNERLRSNSETL
LRSERTDGRNRRLGLASKKASELGTLDETQANVRFSHYRGLSHGSAMQGAPPRSKSPATPTEPYLQRPVYVRRLS
ILPERRRESKIFDPVIEAAKGILYSVFQIHPMIQVLMSLTNDGSAKRSSLEIVLYNTNSHVEELEQEIQKHDTAD
EEVTPIENGNVRRACQTLVSAYGHVCTLLVENIDTFVDDGDARYIRTLLMLLYNSIMELRVTLASITGEHAKARP
PNRQADNVGRTIRPYPREQTTTTPKGDRSGFARSRNGTVVHNPANLRVATDVALPYVNGSGQAVMVTSATPRSGE
SFSSAHSRETGSDFSEDDAQFDRIFLSLQRSADLALRTLPGFQEQLTGGLRNALQQRAPMGMIQDWKSLIAMCNT
TVQQTEILRNRLSLVKLKDPGVRTQPSFWNQCNNFVASWTNMAHKIKAAINTIPLPPDTRLRLRPIQQSMKETSN
TIVQSPWHHLFRPSGIPGGAYASQVTSPTRAQVPITPLSAALGPAMQATVPTTPHFAAAFHGNVFDRADNLIANP
GISMGRNGTMTRGHSGFNSLSSISSMSSDGNTSASSSTFSPNNSLGLLPPRMNGGKVAI*
Coding >Ophun1|4902
ATGGACCGGCTTGATCGAATGCCCGGCCCGGCTTCTCAGCCTTCTGGCGTTCGTGGCCTGCCGGACAATCCCGCT
CAAGGGCGTCGAGCCGTTGGGCCGCCTTATCCTACAATGTCCAACGGTCATCCGCCACCGCCGCCGCCGCCTGCG
CATTCCAAGTCCGGTCCGCGGAAAGCTCCGTCAAACGCGAATTTGTCGGCCTCCAAGGTCATGACTCCCGCGCAG
GTCATGGCTCTTGCGCAACAGGCCATGCAAAACGCCCTCGAGAGCGAGAAGAATCAGGCGGCCGACGTCGATGCT
GTCGGTCCTGGGCTTCGTTCCGGCGTCACCATCGATCTCAGCCGTAAGGATATCCAGAGGCTGCCGGAGGAGGTC
GTCGATATAGTCAAGGATGAGTTGGAACGACTCGCCCTCTCGCACAACCAGTTGACCTCGCTGCCCGCTCGCTTC
TCCGAATGCACTCTCCTGCGCTACCTTAACATACGGGGAAATCAGATCAAGGAGTTTCCCATGCCGCTCTGCGAC
CTCAAGTCTCTAGAGATTCTCGACCTCGGTCGCAACCAGCTGCGGTCGCTGCCAAACGAGCTCTCCAAGCTGTCG
TCTCTGAAAGTGCTGTCGGTGCCCAAGAACCAGATTCGCGAACTTCCAGTCTGCCTCGCCGACATGGTATCACTG
CAAGTCCTCAAATTCGAAGGGAATCCCGTCAGCTTCCCGCCAAAGGACGTGCTGCGACCTCAGAACGGCAGCCCA
CCCAATGACGGCTTTCCGCGGGAGACGGATGTCAACGAGGTCACCATGACGGCATACATCAAAAAATACATGAAG
CAGTATGCCATCCTCGGGCGCACGGACCCCGAGGCCACGGGTGATGAGTCCAGCGAGGGCGCCGAGACTCCGCGA
TTTCCTCTCAAGCGAGCCGCCAGCGGTCGGTTCCCTATCAAGGTCAACGGCGCCGACGTGCCCGATATCCGATCT
CCCAACAGCGGATCACGGCCGCCCATCGTGCCCATTCGGGCGCATTCTCGCGGCCTGTCGCAGCAGAACGCGGCC
ACTCGACGGCCCAACGTGATGCCCCTGACGATAGGCAACGTCAACGAGCGGCTCCGCAGCAACTCGGAGACGCTG
CTGCGCTCGGAGCGCACCGACGGCCGCAACCGTCGCCTCGGCTTGGCCTCAAAGAAGGCATCCGAACTGGGCACC
CTGGACGAGACGCAGGCCAACGTGCGCTTCAGCCACTACCGGGGCCTCAGCCATGGTTCGGCCATGCAGGGCGCT
CCGCCGCGATCCAAGAGCCCGGCGACACCAACGGAACCCTATCTTCAGCGGCCCGTTTACGTTCGCCGGCTGTCT
ATACTTCCGGAGCGCCGACGGGAGTCCAAGATCTTCGACCCGGTCATTGAAGCGGCAAAGGGAATCCTGTACTCC
GTCTTCCAGATCCATCCAATGATCCAGGTGCTCATGTCTCTGACCAACGACGGGTCGGCTAAGCGATCGAGCCTC
GAGATTGTCTTGTACAACACGAATTCACACGTGGAGGAGCTCGAGCAGGAGATACAGAAGCACGACACTGCCGAC
GAAGAGGTGACGCCCATCGAGAACGGTAACGTGCGGCGCGCCTGTCAGACACTGGTGAGCGCGTACGGCCACGTC
TGCACCCTCCTGGTGGAGAATATCGATACATTTGTCGACGACGGAGACGCGCGATACATTCGGACACTCCTGATG
TTGCTGTACAACAGTATCATGGAACTCCGCGTTACACTCGCATCCATCACCGGCGAGCACGCCAAGGCGCGACCG
CCCAACCGTCAGGCTGATAATGTCGGTCGGACGATCCGCCCCTATCCGCGGGAGCAGACGACGACGACGCCCAAG
GGCGATCGGTCAGGGTTCGCACGGTCACGCAACGGGACGGTGGTCCACAACCCGGCCAACCTCCGGGTCGCTACC
GATGTGGCTCTGCCGTACGTCAACGGGTCCGGCCAGGCGGTCATGGTGACGTCGGCGACGCCCCGGTCGGGCGAG
TCCTTCTCGTCGGCCCACAGCCGAGAGACGGGCTCCGACTTTTCCGAGGACGACGCGCAGTTTGACCGCATCTTT
TTGTCTCTGCAACGGTCGGCGGACCTCGCTCTCCGCACGCTGCCAGGCTTCCAGGAGCAGCTGACGGGCGGGCTG
AGGAACGCACTGCAGCAGCGGGCGCCCATGGGCATGATTCAGGACTGGAAGAGCCTGATTGCCATGTGCAACACG
ACGGTGCAGCAGACGGAGATTCTGAGGAACCGGCTGTCACTGGTGAAGCTGAAGGATCCGGGGGTCCGTACGCAG
CCCAGCTTCTGGAACCAGTGCAACAACTTTGTGGCGTCGTGGACCAACATGGCGCACAAGATCAAGGCAGCCATC
AACACGATACCGCTGCCACCGGACACGAGGCTGCGATTGCGGCCGATCCAGCAGAGCATGAAGGAGACGAGCAAC
ACCATCGTGCAGTCGCCATGGCACCACCTGTTCCGGCCCTCGGGGATCCCCGGGGGAGCGTACGCGTCGCAGGTG
ACGTCGCCGACGAGGGCGCAGGTGCCCATCACGCCCCTGAGCGCGGCGCTGGGTCCGGCGATGCAGGCGACGGTG
CCGACGACGCCTCACTTCGCGGCGGCCTTCCACGGCAACGTCTTCGACCGGGCCGACAACTTGATTGCGAATCCG
GGCATCTCGATGGGGCGCAACGGCACCATGACGAGAGGCCACTCGGGCTTCAACTCGCTATCGTCCATCTCGTCC
ATGTCTTCGGACGGCAACACGTCGGCGTCGTCTTCGACGTTTAGCCCCAACAACAGTCTCGGGCTGCTGCCGCCA
CGCATGAACGGTGGCAAGGTGGCGATATGA
Transcript >Ophun1|4902
ATGGACCGGCTTGATCGAATGCCCGGCCCGGCTTCTCAGCCTTCTGGCGTTCGTGGCCTGCCGGACAATCCCGCT
CAAGGGCGTCGAGCCGTTGGGCCGCCTTATCCTACAATGTCCAACGGTCATCCGCCACCGCCGCCGCCGCCTGCG
CATTCCAAGTCCGGTCCGCGGAAAGCTCCGTCAAACGCGAATTTGTCGGCCTCCAAGGTCATGACTCCCGCGCAG
GTCATGGCTCTTGCGCAACAGGCCATGCAAAACGCCCTCGAGAGCGAGAAGAATCAGGCGGCCGACGTCGATGCT
GTCGGTCCTGGGCTTCGTTCCGGCGTCACCATCGATCTCAGCCGTAAGGATATCCAGAGGCTGCCGGAGGAGGTC
GTCGATATAGTCAAGGATGAGTTGGAACGACTCGCCCTCTCGCACAACCAGTTGACCTCGCTGCCCGCTCGCTTC
TCCGAATGCACTCTCCTGCGCTACCTTAACATACGGGGAAATCAGATCAAGGAGTTTCCCATGCCGCTCTGCGAC
CTCAAGTCTCTAGAGATTCTCGACCTCGGTCGCAACCAGCTGCGGTCGCTGCCAAACGAGCTCTCCAAGCTGTCG
TCTCTGAAAGTGCTGTCGGTGCCCAAGAACCAGATTCGCGAACTTCCAGTCTGCCTCGCCGACATGGTATCACTG
CAAGTCCTCAAATTCGAAGGGAATCCCGTCAGCTTCCCGCCAAAGGACGTGCTGCGACCTCAGAACGGCAGCCCA
CCCAATGACGGCTTTCCGCGGGAGACGGATGTCAACGAGGTCACCATGACGGCATACATCAAAAAATACATGAAG
CAGTATGCCATCCTCGGGCGCACGGACCCCGAGGCCACGGGTGATGAGTCCAGCGAGGGCGCCGAGACTCCGCGA
TTTCCTCTCAAGCGAGCCGCCAGCGGTCGGTTCCCTATCAAGGTCAACGGCGCCGACGTGCCCGATATCCGATCT
CCCAACAGCGGATCACGGCCGCCCATCGTGCCCATTCGGGCGCATTCTCGCGGCCTGTCGCAGCAGAACGCGGCC
ACTCGACGGCCCAACGTGATGCCCCTGACGATAGGCAACGTCAACGAGCGGCTCCGCAGCAACTCGGAGACGCTG
CTGCGCTCGGAGCGCACCGACGGCCGCAACCGTCGCCTCGGCTTGGCCTCAAAGAAGGCATCCGAACTGGGCACC
CTGGACGAGACGCAGGCCAACGTGCGCTTCAGCCACTACCGGGGCCTCAGCCATGGTTCGGCCATGCAGGGCGCT
CCGCCGCGATCCAAGAGCCCGGCGACACCAACGGAACCCTATCTTCAGCGGCCCGTTTACGTTCGCCGGCTGTCT
ATACTTCCGGAGCGCCGACGGGAGTCCAAGATCTTCGACCCGGTCATTGAAGCGGCAAAGGGAATCCTGTACTCC
GTCTTCCAGATCCATCCAATGATCCAGGTGCTCATGTCTCTGACCAACGACGGGTCGGCTAAGCGATCGAGCCTC
GAGATTGTCTTGTACAACACGAATTCACACGTGGAGGAGCTCGAGCAGGAGATACAGAAGCACGACACTGCCGAC
GAAGAGGTGACGCCCATCGAGAACGGTAACGTGCGGCGCGCCTGTCAGACACTGGTGAGCGCGTACGGCCACGTC
TGCACCCTCCTGGTGGAGAATATCGATACATTTGTCGACGACGGAGACGCGCGATACATTCGGACACTCCTGATG
TTGCTGTACAACAGTATCATGGAACTCCGCGTTACACTCGCATCCATCACCGGCGAGCACGCCAAGGCGCGACCG
CCCAACCGTCAGGCTGATAATGTCGGTCGGACGATCCGCCCCTATCCGCGGGAGCAGACGACGACGACGCCCAAG
GGCGATCGGTCAGGGTTCGCACGGTCACGCAACGGGACGGTGGTCCACAACCCGGCCAACCTCCGGGTCGCTACC
GATGTGGCTCTGCCGTACGTCAACGGGTCCGGCCAGGCGGTCATGGTGACGTCGGCGACGCCCCGGTCGGGCGAG
TCCTTCTCGTCGGCCCACAGCCGAGAGACGGGCTCCGACTTTTCCGAGGACGACGCGCAGTTTGACCGCATCTTT
TTGTCTCTGCAACGGTCGGCGGACCTCGCTCTCCGCACGCTGCCAGGCTTCCAGGAGCAGCTGACGGGCGGGCTG
AGGAACGCACTGCAGCAGCGGGCGCCCATGGGCATGATTCAGGACTGGAAGAGCCTGATTGCCATGTGCAACACG
ACGGTGCAGCAGACGGAGATTCTGAGGAACCGGCTGTCACTGGTGAAGCTGAAGGATCCGGGGGTCCGTACGCAG
CCCAGCTTCTGGAACCAGTGCAACAACTTTGTGGCGTCGTGGACCAACATGGCGCACAAGATCAAGGCAGCCATC
AACACGATACCGCTGCCACCGGACACGAGGCTGCGATTGCGGCCGATCCAGCAGAGCATGAAGGAGACGAGCAAC
ACCATCGTGCAGTCGCCATGGCACCACCTGTTCCGGCCCTCGGGGATCCCCGGGGGAGCGTACGCGTCGCAGGTG
ACGTCGCCGACGAGGGCGCAGGTGCCCATCACGCCCCTGAGCGCGGCGCTGGGTCCGGCGATGCAGGCGACGGTG
CCGACGACGCCTCACTTCGCGGCGGCCTTCCACGGCAACGTCTTCGACCGGGCCGACAACTTGATTGCGAATCCG
GGCATCTCGATGGGGCGCAACGGCACCATGACGAGAGGCCACTCGGGCTTCAACTCGCTATCGTCCATCTCGTCC
ATGTCTTCGGACGGCAACACGTCGGCGTCGTCTTCGACGTTTAGCCCCAACAACAGTCTCGGGCTGCTGCCGCCA
CGCATGAACGGTGGCAAGGTGGCGATATGA
Gene >Ophun1|4902
ATGGACCGGCTTGATCGAATGCCCGGCCCGGCTTCTCAGCCTTCTGGCGTTCGTGGCCTGCCGGACAATCCCGCT
CAAGGGCGTCGAGCCGTTGGGCCGCCTTATCCTACAATGTCCAACGGTCATCCGCCACCGCCGCCGCCGCCTGCG
CATTCCAAGTCCGGTCCGCGGAAAGCTCCGTCAAACGCGAATTTGTCGGCCTCCAAGGTCATGACTCCCGCGCAG
GTCATGGCTCTTGCGCAACAGGCCATGCAAAACGCCCTCGAGAGCGAGAAGAATCAGGCGGCCGACGTCGATGCT
GTCGGTCCTGGGCTTCGTTCCGGCGTCACCATCGATCTCAGCCGTAAGGATATCCAGAGGCTGCCGGAGGAGGTC
GTCGATATAGTCAAGGATGAGTTGGAACGGTAGGTCGGCCTTGTCTGGTCGCTTTTCCTCGGCTGACGCGCACAA
GACTCGCCCTCTCGCACAACCAGTTGACCTCGCTGCCCGCTCGCTTCTCCGAATGCACTCTCCTGCGCTACCTTA
ACATACGGGGAAATCAGATCAAGGAGTTTCCCATGCCGGTATGCATCATTCATCATCGTCTGCTGGGAGTATTAT
ATGTTGCTGATTCACCCGCTAGCTCTGCGACCTCAAGTCTCTAGAGATTCTCGACCTCGGTCGCAACCAGCTGCG
GTCGCTGCCAAACGAGCTCTCCAAGCTGTCGTCTCTGAAAGTGCTGTCGGTGCCCAAGAACCAGATTCGCGAACT
TCCAGTCTGCCTCGCCGACATGGTATCACTGCAAGTCCTCAAATTCGAAGGGAATCCCGTCAGCTTCCCGCCAAA
GGACGTGCTGCGACCTCAGAACGGCAGCCCACCCAATGACGGCTTTCCGCGGGAGACGGATGTCAACGAGGTCAC
CATGACGGCATACATCAAAAAATACATGAAGCAGTATGCCATCCTCGGGCGCACGGACCCCGAGGCCACGGGTGA
TGAGTCCAGCGAGGGCGCCGAGACTCCGCGATTTCCTCTCAAGCGAGCCGCCAGCGGTCGGTTCCCTATCAAGGT
CAACGGCGCCGACGTGCCCGATATCCGATCTCCCAACAGCGGATCACGGCCGCCCATCGTGCCCATTCGGGCGCA
TTCTCGCGGCCTGTCGCAGCAGAACGCGGCCACTCGACGGCCCAACGTGATGCCCCTGACGATAGGCAACGTCAA
CGAGCGGCTCCGCAGCAACTCGGAGACGCTGCTGCGCTCGGAGCGCACCGACGGCCGCAACCGTCGCCTCGGCTT
GGCCTCAAAGAAGGCATCCGAACTGGGCACCCTGGACGAGACGCAGGCCAACGTGCGCTTCAGCCACTACCGGGG
CCTCAGCCATGGTTCGGCCATGCAGGGCGCTCCGCCGCGATCCAAGAGCCCGGCGACACCAACGGAACCCTATCT
TCAGCGGCCCGTTTACGTTCGCCGGCTGTCTATACTTCCGGAGCGCCGACGGGAGTCCAAGATCTTCGACCCGGT
CATTGAAGCGGCAAAGGGAATCCTGTACTCCGTCTTCCAGATCCATCCAATGATCCAGGTGCTCATGTCTCTGAC
CAACGACGGGTCGGCTAAGCGATCGAGCCTCGAGATTGTCTTGTACAACACGAATTCACACGTGGAGGAGCTCGA
GCAGGAGATACAGAAGCACGACACTGCCGACGAAGAGGTGACGCCCATCGAGAACGGTAACGTGCGGCGCGCCTG
TCAGACACTGGTGAGCGCGTACGGCCACGTCTGCACCCTCCTGGTGGAGAATATCGATACATTTGTCGACGACGG
AGACGCGCGATACATTCGGACACTCCTGATGTTGCTGTACAACAGTATCATGGAACTCCGCGTTACACTCGCATC
CATCACCGGCGAGCACGCCAAGGCGCGACCGCCCAACCGTCAGGCTGATAATGTCGGTCGGACGATCCGCCCCTA
TCCGCGGGAGCAGACGACGACGACGCCCAAGGGCGATCGGTCAGGGTTCGCACGGTCACGCAACGGGACGGTGGT
CCACAACCCGGCCAACCTCCGGGTCGCTACCGATGTGGCTCTGCCGTACGTCAACGGGTCCGGCCAGGCGGTCAT
GGTGACGTCGGCGACGCCCCGGTCGGGCGAGTCCTTCTCGTCGGCCCACAGCCGAGAGACGGGCTCCGACTTTTC
CGAGGACGACGCGCAGTTTGACCGCATCTTTTTGTCTCTGCAACGGTCGGCGGACCTCGCTCTCCGCACGCTGCC
AGGCTTCCAGGAGCAGCTGACGGGCGGGCTGAGGAACGCACTGCAGCAGCGGGCGCCCATGGGCATGATTCAGGA
CTGGAAGAGCCTGATTGCCATGTGCAACACGACGGTGCAGCAGACGGAGATTCTGAGGAACCGGCTGTCACTGGT
GAAGCTGAAGGATCCGGGGGTCCGTACGCAGCCCAGCTTCTGGAACCAGTGCAACAACTTTGTGGCGTCGTGGAC
CAACATGGCGCACAAGATCAAGGCAGCCATCAACACGATACCGCTGCCACCGGACACGAGGCTGCGATTGCGGCC
GATCCAGCAGAGCATGAAGGAGACGAGCAACACCATCGTGCAGTCGCCATGGCACCACCTGTTCCGGCCCTCGGG
GATCCCCGGGGGAGCGTACGCGTCGCAGGTGACGTCGCCGACGAGGGCGCAGGTGCCCATCACGCCCCTGAGCGC
GGCGCTGGGTCCGGCGATGCAGGCGACGGTGCCGACGACGCCTCACTTCGCGGCGGCCTTCCACGGCAACGTCTT
CGACCGGGCCGACAACTTGATTGCGAATCCGGGCATCTCGATGGGGCGCAACGGCACCATGACGAGAGGCCACTC
GGGCTTCAACTCGCTATCGTCCATCTCGTCCATGTCTTCGGACGGCAACACGTCGGCGTCGTCTTCGACGTTTAG
CCCCAACAACAGTCTCGGGCTGCTGCCGCCACGCATGAACGGTGGCAAGGTGGCGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail