Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4898
Gene name
LocationContig_464:10451..10877
Strand-
Gene length (bp)426
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09631 Sen15 Sen15 protein 1.3E-28 19 141

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7RY78|SEN15_NEUCR Probable tRNA-splicing endonuclease subunit tsp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-1 PE=3 SV=1 15 141 9.0E-35
sp|Q04675|SEN15_YEAST tRNA-splicing endonuclease subunit SEN15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN15 PE=1 SV=2 29 141 1.0E-08
sp|Q7LKV3|SEN15_SCHPO Probable tRNA-splicing endonuclease subunit sen15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen15 PE=3 SV=1 15 141 2.0E-08
sp|Q759Y8|SEN15_ASHGO tRNA-splicing endonuclease subunit SEN15 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN15 PE=3 SV=1 19 141 2.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7208
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4060
Ophiocordyceps camponoti-rufipedis Ophun1|4898 (this protein)
Ophiocordyceps kimflemingae Ophio5|1779

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4898
MDSRQSVRPRVVGTICRSVARDLEKQHDWRSLEIVDGPDQLRPLIRGLPPQRLYLHPDDQVLALASEHVTGGKLH
HQPEFEWVLPLHLSEAWSLANFATVFKSVTMVDSTVTKRVLLAIVHSDSTVVYYIMHQGIVKPRQN*
Coding >Ophun1|4898
ATGGATTCTCGGCAATCCGTTCGCCCTCGCGTCGTTGGAACTATATGTCGGAGTGTCGCTCGCGATCTAGAAAAG
CAGCATGACTGGAGGTCACTAGAGATTGTCGACGGCCCGGACCAGCTACGACCCCTCATCCGCGGTCTCCCCCCT
CAACGTCTCTACCTGCATCCAGACGATCAAGTTCTGGCCCTTGCGAGCGAGCACGTCACGGGTGGAAAGCTACAT
CACCAGCCTGAATTTGAATGGGTTTTGCCTCTGCATCTGTCGGAGGCATGGTCACTTGCCAATTTTGCCACCGTT
TTCAAGTCGGTGACAATGGTAGACTCTACCGTGACTAAGCGGGTCCTTTTAGCTATTGTTCACAGCGACTCAACT
GTCGTCTACTACATTATGCACCAGGGCATCGTTAAACCTCGCCAGAATTAG
Transcript >Ophun1|4898
ATGGATTCTCGGCAATCCGTTCGCCCTCGCGTCGTTGGAACTATATGTCGGAGTGTCGCTCGCGATCTAGAAAAG
CAGCATGACTGGAGGTCACTAGAGATTGTCGACGGCCCGGACCAGCTACGACCCCTCATCCGCGGTCTCCCCCCT
CAACGTCTCTACCTGCATCCAGACGATCAAGTTCTGGCCCTTGCGAGCGAGCACGTCACGGGTGGAAAGCTACAT
CACCAGCCTGAATTTGAATGGGTTTTGCCTCTGCATCTGTCGGAGGCATGGTCACTTGCCAATTTTGCCACCGTT
TTCAAGTCGGTGACAATGGTAGACTCTACCGTGACTAAGCGGGTCCTTTTAGCTATTGTTCACAGCGACTCAACT
GTCGTCTACTACATTATGCACCAGGGCATCGTTAAACCTCGCCAGAATTAG
Gene >Ophun1|4898
ATGGATTCTCGGCAATCCGTTCGCCCTCGCGTCGTTGGAACTATATGTCGGAGTGTCGCTCGCGATCTAGAAAAG
CAGCATGACTGGAGGTCACTAGAGATTGTCGACGGCCCGGACCAGCTACGACCCCTCATCCGCGGTCTCCCCCCT
CAACGTCTCTACCTGCATCCAGACGATCAAGTTCTGGCCCTTGCGAGCGAGCACGTCACGGGTGGAAAGCTACAT
CACCAGCCTGAATTTGAATGGGTTTTGCCTCTGCATCTGTCGGAGGCATGGTCACTTGCCAATTTTGCCACCGTT
TTCAAGTCGGTGACAATGGTAGACTCTACCGTGACTAAGCGGGTCCTTTTAGCTATTGTTCACAGCGACTCAACT
GTCGTCTACTACATTATGCACCAGGGCATCGTTAAACCTCGCCAGAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail