Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4891
Gene name
LocationContig_462:6794..10154
Strand-
Gene length (bp)3360
Transcript length (bp)3018
Coding sequence length (bp)3018
Protein length (aa) 1006

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06032 DUF917 Protein of unknown function (DUF917) 2.7E-104 631 983
PF05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region 1.1E-24 5 183
PF01968 Hydantoinase_A Hydantoinase/oxoprolinase 4.9E-17 205 402

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01262|HYUA_PSESN Hydantoin utilization protein A OS=Pseudomonas sp. (strain NS671) GN=hyuA PE=3 SV=1 1 405 1.0E-15
sp|Q58374|Y964_METJA Uncharacterized protein MJ0964 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0964 PE=3 SV=1 4 377 1.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4438
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5913
Ophiocordyceps australis map64 (Brazil) OphauB2|2355
Ophiocordyceps camponoti-floridani Ophcf2|00697
Ophiocordyceps camponoti-rufipedis Ophun1|4891 (this protein)
Ophiocordyceps kimflemingae Ophio5|7070
Ophiocordyceps subramaniannii Hirsu2|9201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4891
MSLYRIGVDVGGTNTDAAILDLTALDQPGRGVLASHKTSTTADITGGIEASIRAVLQASAVDQDGVLSVTIGTTH
FINALVEADARRLDRVAVIRLCGPFTRQLPPLSGFPVGLRRVLDGGVHYLDGGLEMDGREISALDPEQIRRAARE
IVAQGVGAVALVGVFSPLDHEGVHEERCREILLSEAPRLRVVCSRSMGSTGLLERENATILNAAILRTARRVERG
FRRAMRRLRLRCPLFLSQNDGTLIDARVAAEMPIKTFASGPTNSMTGAAFLAGIDLAASVEADQGNGGDGDGAPQ
VLVVDIGGTTTDVCSLLPSGFPRQAPGFVELGGVRTAFSMPEVLSVGLGGGSRVVVHDEAGPDPHAGSVSVGPAS
VGHRLREQARVFGGPTLTATDVIVAAGGADHLGDASLVRDLLPRATVDLACDDIRRKLEALIDRMRVSAAPVHVL
LVGGGAILVKDGELAGVDKCIRPVHQGAANAVGAAIANVSGEVDCLEVLGKREERDLLDAACRRAVDLAVEKGAS
RDDVRVVEITKTPLQYMSQETIRIQVRAVGRLAIPSGPAPSWSGAESPVSDSDEDHLDDDDDDDDDTQKATIPDA
LTPTTKPTLGIDLAAYRPEVRAGTWYVSEIDLELIATGCGVLGTGGGGPTYYEYLKSLHCRRGPDGGKMRVISAQ
SLQDDDVVCFGSWYGSPSVINERIPAGGEIAAAVDAVNGIKGVRSFAALCLVEIGGGNGLCAFPNGVHYDCPVID
GDAMGRAYPTLFHTTFSVYGYEPTPCSVTDALGNVVVAMKTETPYHLEKLIRTASVEMGLSCASSPNPLPASAIK
THSVPNTMSQAWYLGRAFGVCAGKLLFTGKITDVHRYIGGGYTMGAVLLAPLSDEERESPAIASRQQVPTDKHMI
IPFQNEYLYAAHCDSVGSEPSREVVCTVPSLISILGQDGEAIGSQDLRYGLRVNVITLPAHPLWRSSQALKVGGP
EGFGLKMAEVAVDTGEEFTAARSVIDEFGE*
Coding >Ophun1|4891
ATGTCCCTCTACCGCATCGGCGTCGACGTCGGCGGCACCAACACCGATGCCGCCATCCTCGACCTCACAGCCCTC
GACCAGCCCGGCCGCGGCGTCCTGGCCTCGCACAAGACGTCCACCACAGCTGACATCACAGGCGGCATCGAGGCC
TCCATCCGTGCCGTTCTCCAGGCCTCGGCCGTGGACCAAGATGGCGTCCTGAGCGTCACCATTGGCACCACGCAC
TTTATCAACGCCCTGGTCGAGGCAGATGCCCGTCGTCTCGACCGCGTGGCCGTCATCCGTCTCTGTGGGCCTTTT
ACGCGTCAGCTGCCGCCTCTCTCCGGCTTCCCCGTCGGTCTTCGCCGCGTTCTCGACGGAGGTGTTCACTATCTC
GACGGCGGACTGGAGATGGACGGCCGCGAGATATCGGCCTTGGATCCGGAGCAGATCCGCCGCGCAGCCCGCGAG
ATAGTAGCCCAGGGAGTCGGAGCCGTTGCCCTCGTCGGCGTCTTTTCACCGCTAGACCACGAGGGCGTCCACGAA
GAGCGCTGTCGCGAGATTCTTCTCAGCGAGGCTCCTCGTCTACGCGTCGTCTGCTCGCGGTCCATGGGCTCGACT
GGTCTTTTGGAGCGGGAGAACGCGACGATTCTCAACGCCGCTATTCTACGGACGGCTCGGCGTGTAGAAAGGGGT
TTCCGACGGGCTATGCGTCGTCTTCGTCTCCGCTGTCCGCTCTTCTTGTCGCAGAATGACGGCACGCTCATCGAC
GCCCGTGTTGCCGCTGAGATGCCCATCAAGACATTTGCCAGCGGACCGACCAACAGCATGACGGGCGCTGCTTTT
CTAGCGGGCATTGATCTAGCCGCCTCTGTGGAAGCCGATCAGGGCAACGGAGGCGATGGCGACGGAGCGCCTCAG
GTGTTGGTGGTCGACATCGGCGGCACAACCACCGACGTCTGCTCCCTGCTACCCTCAGGCTTCCCTCGCCAAGCC
CCAGGCTTCGTCGAGCTCGGCGGCGTACGCACCGCCTTTTCCATGCCCGAGGTGCTCTCCGTCGGTCTCGGCGGC
GGAAGCCGGGTGGTGGTTCACGACGAGGCCGGGCCGGACCCACATGCCGGCTCCGTGTCGGTCGGTCCGGCGTCG
GTCGGACACCGGCTTCGAGAGCAGGCGCGTGTCTTTGGCGGACCGACTCTGACGGCTACGGATGTGATTGTTGCT
GCTGGGGGTGCTGATCATCTTGGCGATGCGAGTCTTGTTCGCGATTTGCTGCCCCGGGCTACGGTTGATCTCGCC
TGTGACGATATCCGGCGCAAGCTCGAGGCCTTGATCGACCGGATGAGGGTTTCTGCCGCGCCGGTACACGTTCTT
CTCGTTGGCGGAGGCGCCATCCTCGTCAAGGACGGAGAGCTGGCGGGCGTTGACAAGTGTATTCGACCTGTGCAT
CAGGGGGCGGCCAATGCGGTTGGGGCAGCCATCGCCAACGTCTCGGGCGAGGTCGACTGTCTCGAGGTGCTGGGC
AAGAGAGAAGAGAGGGATCTTCTTGATGCTGCGTGTCGGCGGGCTGTTGATCTGGCGGTGGAAAAGGGGGCCAGT
CGCGATGACGTGCGTGTTGTTGAGATCACCAAGACGCCGCTTCAGTACATGTCGCAAGAGACGATCCGGATCCAG
GTCCGTGCTGTGGGCCGGCTGGCTATCCCTTCCGGTCCGGCTCCGAGCTGGTCCGGCGCCGAGTCTCCGGTGAGC
GACTCCGATGAGGATCATCTGGACGACGACGACGACGACGACGATGACACGCAAAAGGCCACCATCCCAGACGCC
CTCACCCCGACGACCAAGCCAACTCTCGGCATCGACCTCGCTGCCTACCGCCCTGAAGTCCGCGCCGGCACCTGG
TACGTCTCCGAGATAGACCTCGAGCTCATCGCCACCGGCTGCGGCGTCCTCGGCACTGGAGGAGGCGGCCCGACC
TACTACGAGTATCTCAAGAGTCTGCACTGCCGACGCGGACCGGACGGCGGAAAGATGAGAGTCATATCAGCCCAG
TCGCTTCAAGACGATGACGTGGTATGCTTCGGGTCGTGGTATGGCAGCCCGAGCGTCATCAACGAACGGATCCCG
GCTGGGGGCGAGATTGCGGCGGCTGTCGATGCTGTGAATGGCATCAAGGGCGTGAGATCCTTTGCTGCGCTTTGT
CTTGTTGAGATCGGTGGCGGCAATGGTCTCTGTGCCTTTCCCAACGGCGTTCACTACGACTGCCCTGTCATTGAT
GGCGATGCCATGGGGAGGGCCTATCCAACCTTGTTCCACACCACCTTTAGCGTCTACGGCTACGAACCGACGCCA
TGCTCCGTGACGGATGCCCTCGGCAACGTCGTCGTCGCCATGAAAACAGAGACGCCTTACCACCTCGAGAAGCTC
ATCCGCACAGCATCCGTCGAGATGGGCCTGTCGTGTGCGTCGAGTCCGAATCCGCTTCCGGCATCGGCCATCAAG
ACGCACAGCGTGCCGAATACCATGTCGCAGGCCTGGTATCTGGGCCGAGCCTTCGGCGTCTGCGCTGGAAAGCTG
CTCTTCACCGGCAAAATCACAGACGTCCACCGCTACATCGGCGGCGGCTACACCATGGGCGCCGTCCTGCTCGCC
CCCCTGAGCGACGAGGAGCGAGAGTCGCCCGCCATCGCCAGCCGCCAGCAGGTCCCGACAGACAAACACATGATC
ATCCCGTTCCAGAACGAGTATCTTTATGCTGCCCACTGCGATTCGGTCGGTTCCGAGCCGTCACGCGAGGTCGTC
TGCACCGTCCCGAGCCTCATCTCCATCCTCGGCCAGGACGGTGAGGCCATCGGATCTCAGGACCTGCGGTACGGC
CTCCGCGTCAACGTCATTACCCTGCCAGCGCACCCGCTGTGGCGGTCGAGTCAGGCTCTCAAAGTGGGAGGCCCG
GAAGGCTTCGGCTTGAAGATGGCCGAAGTCGCCGTCGATACGGGCGAGGAGTTTACGGCGGCACGGAGTGTGATA
GACGAGTTTGGGGAATAG
Transcript >Ophun1|4891
ATGTCCCTCTACCGCATCGGCGTCGACGTCGGCGGCACCAACACCGATGCCGCCATCCTCGACCTCACAGCCCTC
GACCAGCCCGGCCGCGGCGTCCTGGCCTCGCACAAGACGTCCACCACAGCTGACATCACAGGCGGCATCGAGGCC
TCCATCCGTGCCGTTCTCCAGGCCTCGGCCGTGGACCAAGATGGCGTCCTGAGCGTCACCATTGGCACCACGCAC
TTTATCAACGCCCTGGTCGAGGCAGATGCCCGTCGTCTCGACCGCGTGGCCGTCATCCGTCTCTGTGGGCCTTTT
ACGCGTCAGCTGCCGCCTCTCTCCGGCTTCCCCGTCGGTCTTCGCCGCGTTCTCGACGGAGGTGTTCACTATCTC
GACGGCGGACTGGAGATGGACGGCCGCGAGATATCGGCCTTGGATCCGGAGCAGATCCGCCGCGCAGCCCGCGAG
ATAGTAGCCCAGGGAGTCGGAGCCGTTGCCCTCGTCGGCGTCTTTTCACCGCTAGACCACGAGGGCGTCCACGAA
GAGCGCTGTCGCGAGATTCTTCTCAGCGAGGCTCCTCGTCTACGCGTCGTCTGCTCGCGGTCCATGGGCTCGACT
GGTCTTTTGGAGCGGGAGAACGCGACGATTCTCAACGCCGCTATTCTACGGACGGCTCGGCGTGTAGAAAGGGGT
TTCCGACGGGCTATGCGTCGTCTTCGTCTCCGCTGTCCGCTCTTCTTGTCGCAGAATGACGGCACGCTCATCGAC
GCCCGTGTTGCCGCTGAGATGCCCATCAAGACATTTGCCAGCGGACCGACCAACAGCATGACGGGCGCTGCTTTT
CTAGCGGGCATTGATCTAGCCGCCTCTGTGGAAGCCGATCAGGGCAACGGAGGCGATGGCGACGGAGCGCCTCAG
GTGTTGGTGGTCGACATCGGCGGCACAACCACCGACGTCTGCTCCCTGCTACCCTCAGGCTTCCCTCGCCAAGCC
CCAGGCTTCGTCGAGCTCGGCGGCGTACGCACCGCCTTTTCCATGCCCGAGGTGCTCTCCGTCGGTCTCGGCGGC
GGAAGCCGGGTGGTGGTTCACGACGAGGCCGGGCCGGACCCACATGCCGGCTCCGTGTCGGTCGGTCCGGCGTCG
GTCGGACACCGGCTTCGAGAGCAGGCGCGTGTCTTTGGCGGACCGACTCTGACGGCTACGGATGTGATTGTTGCT
GCTGGGGGTGCTGATCATCTTGGCGATGCGAGTCTTGTTCGCGATTTGCTGCCCCGGGCTACGGTTGATCTCGCC
TGTGACGATATCCGGCGCAAGCTCGAGGCCTTGATCGACCGGATGAGGGTTTCTGCCGCGCCGGTACACGTTCTT
CTCGTTGGCGGAGGCGCCATCCTCGTCAAGGACGGAGAGCTGGCGGGCGTTGACAAGTGTATTCGACCTGTGCAT
CAGGGGGCGGCCAATGCGGTTGGGGCAGCCATCGCCAACGTCTCGGGCGAGGTCGACTGTCTCGAGGTGCTGGGC
AAGAGAGAAGAGAGGGATCTTCTTGATGCTGCGTGTCGGCGGGCTGTTGATCTGGCGGTGGAAAAGGGGGCCAGT
CGCGATGACGTGCGTGTTGTTGAGATCACCAAGACGCCGCTTCAGTACATGTCGCAAGAGACGATCCGGATCCAG
GTCCGTGCTGTGGGCCGGCTGGCTATCCCTTCCGGTCCGGCTCCGAGCTGGTCCGGCGCCGAGTCTCCGGTGAGC
GACTCCGATGAGGATCATCTGGACGACGACGACGACGACGACGATGACACGCAAAAGGCCACCATCCCAGACGCC
CTCACCCCGACGACCAAGCCAACTCTCGGCATCGACCTCGCTGCCTACCGCCCTGAAGTCCGCGCCGGCACCTGG
TACGTCTCCGAGATAGACCTCGAGCTCATCGCCACCGGCTGCGGCGTCCTCGGCACTGGAGGAGGCGGCCCGACC
TACTACGAGTATCTCAAGAGTCTGCACTGCCGACGCGGACCGGACGGCGGAAAGATGAGAGTCATATCAGCCCAG
TCGCTTCAAGACGATGACGTGGTATGCTTCGGGTCGTGGTATGGCAGCCCGAGCGTCATCAACGAACGGATCCCG
GCTGGGGGCGAGATTGCGGCGGCTGTCGATGCTGTGAATGGCATCAAGGGCGTGAGATCCTTTGCTGCGCTTTGT
CTTGTTGAGATCGGTGGCGGCAATGGTCTCTGTGCCTTTCCCAACGGCGTTCACTACGACTGCCCTGTCATTGAT
GGCGATGCCATGGGGAGGGCCTATCCAACCTTGTTCCACACCACCTTTAGCGTCTACGGCTACGAACCGACGCCA
TGCTCCGTGACGGATGCCCTCGGCAACGTCGTCGTCGCCATGAAAACAGAGACGCCTTACCACCTCGAGAAGCTC
ATCCGCACAGCATCCGTCGAGATGGGCCTGTCGTGTGCGTCGAGTCCGAATCCGCTTCCGGCATCGGCCATCAAG
ACGCACAGCGTGCCGAATACCATGTCGCAGGCCTGGTATCTGGGCCGAGCCTTCGGCGTCTGCGCTGGAAAGCTG
CTCTTCACCGGCAAAATCACAGACGTCCACCGCTACATCGGCGGCGGCTACACCATGGGCGCCGTCCTGCTCGCC
CCCCTGAGCGACGAGGAGCGAGAGTCGCCCGCCATCGCCAGCCGCCAGCAGGTCCCGACAGACAAACACATGATC
ATCCCGTTCCAGAACGAGTATCTTTATGCTGCCCACTGCGATTCGGTCGGTTCCGAGCCGTCACGCGAGGTCGTC
TGCACCGTCCCGAGCCTCATCTCCATCCTCGGCCAGGACGGTGAGGCCATCGGATCTCAGGACCTGCGGTACGGC
CTCCGCGTCAACGTCATTACCCTGCCAGCGCACCCGCTGTGGCGGTCGAGTCAGGCTCTCAAAGTGGGAGGCCCG
GAAGGCTTCGGCTTGAAGATGGCCGAAGTCGCCGTCGATACGGGCGAGGAGTTTACGGCGGCACGGAGTGTGATA
GACGAGTTTGGGGAATAG
Gene >Ophun1|4891
ATGTCCCTCTACCGCATCGGCGTCGACGTCGGCGGCACCAACACCGATGCCGCCATCCTCGACCTCACAGCCCTC
GACCAGCCCGGCCGCGGCGTCCTGGCCTCGCACAAGACGTCCACCACAGCTGACATCACAGGCGGCATCGAGGCC
TCCATCCGTGCCGTTCTCCAGGCCTCGGCCGTGGACCAAGATGGCGTCCTGAGCGTCACCATTGGCACCACGCAC
TTTATCAACGCCCTGGTCGAGGCAGATGCCCGTCGTCTCGACCGCGTGGCCGTCATCCGTCTCTGTGGGCCTTTT
ACGCGTCAGCTGCCGCCTCTCTCCGGCTTCCCCGTCGGTCTTCGCCGCGTTCTCGACGGAGGTGTTCACTATCTC
GACGGCGGACTGGAGATGGACGGCCGCGAGATATCGGCCTTGGATCCGGAGCAGATCCGCCGCGCAGCCCGCGAG
ATAGTAGCCCAGGGAGTCGGAGCCGTTGCCCTCGTCGGCGTCTTTTCACCGCTAGACCACGAGGGCGTCCACGAA
GAGCGCTGTCGCGAGATTCTTCTCAGCGAGGCTCCTCGTCTACGCGTCGTCTGCTCGCGGTCCATGGGCTCGACT
GGTCTTTTGGAGCGGGAGAACGCGACGATTCTCAACGCCGCTATTCTACGGACGGCTCGGCGTGTAGAAAGGGGT
TTCCGACGGGCTATGCGTCGTCTTCGTCTCCGCTGTCCGCTCTTCTTGTCGCAGAATGACGGCACGCTCATCGAC
GCCCGTGTTGCCGCTGAGATGCCCATCAAGACATTTGCCAGCGGACCGACCAACAGCATGACGGGCGCTGCTTTT
CTAGCGGGCATTGATCTAGCCGCCTCTGTGGAAGCCGATCAGGGCAACGGAGGCGATGGCGACGGAGCGCCTCAG
GTGTTGGTGGTCGACATCGGCGGCACAACCACCGACGTCTGCTCCCTGCTACCCTCAGGCTTCCCTCGCCAAGCC
CCAGGCTTCGTCGAGCTCGGCGGCGTACGCACCGCCTTTTCCATGCCCGAGGTGCTCTCCGTCGGTCTCGGCGGC
GGAAGCCGGGTGGTGGTTCACGACGAGGCCGGGCCGGACCCACATGCCGGCTCCGTGTCGGTCGGTCCGGCGTCG
GTCGGACACCGGCTTCGAGAGCAGGCGCGTGTCTTTGGCGGACCGACTCTGACGGCTACGGATGTGATTGTTGCT
GCTGGGGGTGCTGATCATCTTGGCGATGCGAGTCTTGTTCGCGATTTGCTGCCCCGGGCTACGGTTGATCTCGCC
TGTGACGATATCCGGCGCAAGCTCGAGGCCTTGATCGACCGGATGAGGGTTTCTGCCGCGCCGGTACACGTTCTT
CTCGTTGGCGGAGGCGCCATCCTCGTCAAGGACGGAGAGCTGGCGGGCGTTGACAAGTGTATTCGACCTGTGCAT
CAGGGGGCGGCCAATGCGGTTGGGGCAGCCATCGCCAACGTCTCGGGCGAGGTCGACTGTCTCGAGGTGCTGGGC
AAGAGAGAAGAGAGGGATCTTCTTGATGCTGCGTGTCGGCGGGCTGTTGATCTGGCGGTGGAAAAGGGGGCCAGT
CGCGATGACGTGCGTGTTGTTGAGATCACCAAGACGCCGCTTCAGTACATGTCGCAAGAGACGATCCGGATCCAG
GTCCGTGCTGTGGGCCGGCTGGCTATCCCTTCCGGTCCGGCTCCGAGCTGGTCCGGCGCCGAGTCTCCGGTGAGC
GACTCCGATGAGGATCATCTGGACGACGACGACGACGACGACGATGACACGCAAAAGGCCACCATCCCAGACGCC
CTCACCCCGACGACCAAGCCAACTCTCGGCATCGACCTCGCTGCCTACCGCCCTGAAGTCCGCGCCGGCACCTGG
TACGTCTCCGAGATAGACCTCGAGCTCATCGCCACCGGCTGCGGCGTCCTCGGCACTGGAGGAGGCGGCCCGACC
TACTACGAGTATCTCAAGAGTCTGCACTGCCGACGCGGACCGGACGGCGGAAAGATGAGAGTCATATCAGCCCAG
TCGCTTCAAGACGATGACGTGGTATGCTTCGGGTCGTGGTATGGCAGCCCGAGCGTCATCAACGAACGGATCCCG
GCTGGGGGCGAGATTGCGGCGGCTGTCGATGCTGTGAATGGCATCAAGGGCGTGAGATCCTTTGCTGCGCTTTGT
CTTGTTGAGATGTGAGCTGCTCTTTTACTCTGTTGTTCTTGCCCCTGACTATATGATGCTTCAGCGGTGGCGGCA
ATGGTCTCTGTGCCTTTCCCAACGGCGTTCACTACGACTGCCCTGTCATTGATGGCGATGCCATGGGGAGGGCCT
ATCCAACCTTGTTCCACAGTGAGTTCCTCATATTTTTTCGAATATCCCGTCTTTCTGCTTACATCGAGAAGCCAC
CTTTAGCGTCTACGGCTACGAACCGACGCCATGCTCCGTGACGGATGCCCTCGGCAACGTCGTCGTCGCCATGGT
GTGTATATTCTCCTCCCCCTGCGGCCTGAGAGCAGCCGGCTAAGACTACGATAGAAAACAGAGACGCCTTACCAC
CTCGAGAAGCTCATCCGCACAGCATCCGTCGAGATGGGCCTGTCGTGTGCGTCGAGTCCGAATCCGCTTCCGGCA
TCGGCCATCAAGACGCACAGCGTGCCGAATACCATGTCGCAGGCCTGGTATCTGGGCCGAGCCGTACACATGGCC
AGACGCAGCAAAACGAGCTACGTGGATGCCATTGTAAGCACTTCTTCTGCCGTCTGATTCTCTTTGTTCCATCTT
CCCTAGACATCTTTCATGTTACCCCTGAACAACCCCTTTTCCACCACTCCCGCTTTCCCTTCATCGCTACCTCTC
CAGCTCACACCCATACAGTTCGGCGTCTGCGCTGGAAAGCTGCTCTTCACCGGCAAAATCACAGACGTCCACCGC
TACATCGGCGGCGGCTACACCATGGGCGCCGTCCTGCTCGCCCCCCTGAGCGACGAGGAGCGAGAGTCGCCCGCC
ATCGCCAGCCGCCAGCAGGTCCCGACAGACAAACACATGATCATCCCGTTCCAGAACGAGTATCTTTATGCTGCC
CACTGCGATTCGGTCGGTTCCGAGCCGTCACGCGAGGTCGTCTGCACCGTCCCGAGCCTCATCTCCATCCTCGGC
CAGGACGGTGAGGCCATCGGATCTCAGGACCTGCGGTACGGCCTCCGCGTCAACGTCATTACCCTGCCAGCGCAC
CCGCTGTGGCGGTCGAGTCAGGCTCTCAAAGTGGGAGGCCCGGAAGGCTTCGGCTTGAAGATGGCCGAAGTCGCC
GTCGATACGGGCGAGGAGTTTACGGCGGCACGGAGTGTGATAGACGAGTTTGGGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail