Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4888
Gene name
LocationContig_461:10869..12761
Strand+
Gene length (bp)1892
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.1E-42 310 534
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.9E-26 277 520

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28708|PRR1_YEAST Serine/threonine-protein kinase PRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR1 PE=1 SV=1 271 589 2.0E-60
sp|O74815|PPK27_SCHPO Serine/threonine-protein kinase ppk27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk27 PE=3 SV=1 313 537 4.0E-42
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 271 588 7.0E-33
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 271 588 8.0E-33
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 271 511 9.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28708|PRR1_YEAST Serine/threonine-protein kinase PRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR1 PE=1 SV=1 271 589 2.0E-60
sp|O74815|PPK27_SCHPO Serine/threonine-protein kinase ppk27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk27 PE=3 SV=1 313 537 4.0E-42
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 271 588 7.0E-33
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 271 588 8.0E-33
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 271 511 9.0E-33
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 271 511 9.0E-33
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 261 511 1.0E-32
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 261 511 1.0E-32
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 271 511 1.0E-32
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 232 513 3.0E-32
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 277 511 3.0E-32
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 277 511 4.0E-32
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 270 513 4.0E-32
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 271 511 6.0E-32
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 277 511 8.0E-32
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 271 511 9.0E-32
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 271 511 1.0E-31
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 277 511 2.0E-31
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 277 511 2.0E-31
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 277 511 3.0E-31
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 271 511 5.0E-31
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 271 511 5.0E-31
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 271 511 7.0E-31
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 277 511 2.0E-30
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 266 511 5.0E-30
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 264 511 5.0E-30
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 264 511 6.0E-30
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 277 535 9.0E-30
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 340 511 9.0E-30
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 258 511 1.0E-29
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 270 510 1.0E-29
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 277 511 2.0E-29
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 270 511 2.0E-29
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 277 511 3.0E-29
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 239 511 3.0E-29
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 277 511 4.0E-29
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 261 511 5.0E-29
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 277 510 7.0E-29
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 277 511 9.0E-29
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 277 511 9.0E-29
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 277 511 1.0E-28
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 277 510 1.0E-28
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 237 510 1.0E-28
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 261 511 1.0E-28
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 261 511 1.0E-28
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 261 511 1.0E-28
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 246 515 1.0E-28
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 277 510 1.0E-28
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 311 511 1.0E-28
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 263 511 2.0E-28
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 277 511 3.0E-28
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 277 511 3.0E-28
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 263 511 6.0E-28
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 271 510 7.0E-28
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 261 510 7.0E-28
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 277 524 7.0E-28
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 263 517 8.0E-28
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 270 511 1.0E-27
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 274 589 1.0E-27
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 277 517 1.0E-27
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 274 589 1.0E-27
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 274 511 1.0E-27
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 258 511 2.0E-27
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 341 511 2.0E-27
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 263 517 2.0E-27
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 253 511 3.0E-27
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 275 511 3.0E-27
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 319 511 3.0E-27
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 275 511 4.0E-27
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 271 511 4.0E-27
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 268 532 5.0E-27
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 268 595 5.0E-27
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 319 511 6.0E-27
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 268 510 9.0E-27
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 277 511 1.0E-26
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 277 511 1.0E-26
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 311 511 1.0E-26
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 277 511 2.0E-26
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 340 515 2.0E-26
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 267 522 2.0E-26
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 271 515 2.0E-26
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 334 511 3.0E-26
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 311 511 3.0E-26
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 277 511 4.0E-26
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 334 511 4.0E-26
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 311 511 4.0E-26
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 334 511 4.0E-26
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 268 510 4.0E-26
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 277 511 4.0E-26
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 260 592 4.0E-26
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 271 511 5.0E-26
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 277 511 6.0E-26
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 334 511 6.0E-26
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 318 530 6.0E-26
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 277 516 9.0E-26
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 259 511 1.0E-25
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 253 511 1.0E-25
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 277 517 1.0E-25
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 236 510 1.0E-25
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 259 511 1.0E-25
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 268 511 1.0E-25
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 277 511 2.0E-25
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 318 510 2.0E-25
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 277 510 4.0E-25
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 262 511 4.0E-25
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 311 511 5.0E-25
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 271 511 5.0E-25
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 236 545 5.0E-25
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 244 510 5.0E-25
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 268 510 6.0E-25
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 264 510 6.0E-25
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 277 511 6.0E-25
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 277 593 6.0E-25
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 236 545 7.0E-25
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 318 530 7.0E-25
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 277 538 7.0E-25
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 277 518 8.0E-25
sp|Q6SA08|TSSK4_HUMAN Testis-specific serine/threonine-protein kinase 4 OS=Homo sapiens GN=TSSK4 PE=1 SV=1 311 511 8.0E-25
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 277 510 8.0E-25
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 277 511 1.0E-24
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 277 511 1.0E-24
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 275 511 1.0E-24
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 236 510 1.0E-24
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 312 603 1.0E-24
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 310 540 1.0E-24
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 318 524 2.0E-24
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 277 511 2.0E-24
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 340 511 2.0E-24
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 262 511 2.0E-24
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 244 510 2.0E-24
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 310 511 2.0E-24
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 277 511 2.0E-24
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 265 513 2.0E-24
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 315 540 2.0E-24
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 277 517 3.0E-24
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 277 511 3.0E-24
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 247 510 3.0E-24
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 331 514 4.0E-24
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 277 588 4.0E-24
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 269 511 5.0E-24
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 310 511 6.0E-24
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 277 517 6.0E-24
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 268 516 7.0E-24
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 310 587 7.0E-24
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 268 511 1.0E-23
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 277 588 1.0E-23
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 277 510 1.0E-23
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 270 510 1.0E-23
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 318 530 1.0E-23
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 318 513 1.0E-23
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 277 588 2.0E-23
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 268 510 2.0E-23
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 315 540 2.0E-23
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 315 540 2.0E-23
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 271 510 2.0E-23
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 265 511 2.0E-23
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 268 510 2.0E-23
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 268 521 2.0E-23
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 304 510 2.0E-23
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 340 588 2.0E-23
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 268 540 2.0E-23
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 277 589 3.0E-23
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 268 540 3.0E-23
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 308 523 3.0E-23
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 316 540 3.0E-23
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 277 524 3.0E-23
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 277 511 3.0E-23
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 174 590 4.0E-23
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 268 521 4.0E-23
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 233 523 4.0E-23
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 318 530 4.0E-23
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 340 511 5.0E-23
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 268 541 5.0E-23
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 265 589 5.0E-23
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 271 510 6.0E-23
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 340 510 6.0E-23
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 310 511 6.0E-23
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 271 510 8.0E-23
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 317 540 8.0E-23
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 277 599 8.0E-23
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 277 588 8.0E-23
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 277 510 8.0E-23
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 277 538 9.0E-23
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 277 588 9.0E-23
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 310 510 1.0E-22
sp|P43291|SRK2A_ARATH Serine/threonine-protein kinase SRK2A OS=Arabidopsis thaliana GN=SRK2A PE=1 SV=1 313 540 1.0E-22
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 310 540 1.0E-22
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 242 510 1.0E-22
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 263 588 1.0E-22
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 277 510 1.0E-22
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 265 590 1.0E-22
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 340 513 1.0E-22
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 277 588 1.0E-22
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 265 589 2.0E-22
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 270 511 2.0E-22
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 335 590 2.0E-22
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 315 535 2.0E-22
sp|Q9C958|SRK2B_ARATH Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana GN=SRK2B PE=1 SV=1 313 540 2.0E-22
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 236 504 2.0E-22
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 340 511 2.0E-22
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 277 511 2.0E-22
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 332 588 2.0E-22
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 277 510 3.0E-22
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 277 589 3.0E-22
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 340 510 3.0E-22
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 219 553 3.0E-22
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 335 511 3.0E-22
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 277 598 3.0E-22
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 277 589 3.0E-22
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 247 510 3.0E-22
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 262 510 4.0E-22
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 237 510 4.0E-22
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 277 510 4.0E-22
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 267 511 4.0E-22
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 247 510 4.0E-22
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 307 590 4.0E-22
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 335 590 4.0E-22
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 277 510 4.0E-22
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 277 511 4.0E-22
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 229 511 5.0E-22
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 247 510 5.0E-22
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 277 522 5.0E-22
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 337 590 5.0E-22
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 277 510 5.0E-22
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 339 589 5.0E-22
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 307 590 5.0E-22
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 318 516 5.0E-22
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 340 518 5.0E-22
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 343 511 6.0E-22
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 335 511 6.0E-22
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 291 590 6.0E-22
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 291 590 7.0E-22
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 277 530 7.0E-22
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 291 590 7.0E-22
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 310 540 7.0E-22
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 271 510 7.0E-22
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 258 510 7.0E-22
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 277 589 8.0E-22
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 310 540 8.0E-22
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 277 510 9.0E-22
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 277 510 9.0E-22
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 342 510 1.0E-21
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 233 511 1.0E-21
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 277 510 1.0E-21
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 237 588 1.0E-21
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 339 588 1.0E-21
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 230 588 1.0E-21
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 271 510 1.0E-21
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 230 510 1.0E-21
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 277 532 1.0E-21
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 277 511 1.0E-21
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 246 510 1.0E-21
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 277 589 1.0E-21
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 271 510 1.0E-21
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 334 510 2.0E-21
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 277 510 2.0E-21
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 343 510 2.0E-21
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 318 515 2.0E-21
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 271 510 2.0E-21
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 277 510 2.0E-21
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 271 510 2.0E-21
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 335 590 2.0E-21
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 277 511 2.0E-21
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 271 510 2.0E-21
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 340 510 2.0E-21
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 258 510 2.0E-21
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 271 510 3.0E-21
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 313 535 3.0E-21
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 258 510 3.0E-21
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 271 510 3.0E-21
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 265 588 3.0E-21
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 340 590 3.0E-21
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 258 510 3.0E-21
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 258 510 3.0E-21
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 263 510 4.0E-21
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 247 510 4.0E-21
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 271 510 4.0E-21
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 258 510 4.0E-21
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 234 510 4.0E-21
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 341 510 4.0E-21
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 334 525 4.0E-21
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 258 510 5.0E-21
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 336 588 5.0E-21
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 310 540 5.0E-21
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 232 511 5.0E-21
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 271 511 5.0E-21
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 277 510 5.0E-21
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 277 510 5.0E-21
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 340 511 6.0E-21
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 230 511 6.0E-21
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 271 511 7.0E-21
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 311 510 7.0E-21
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 258 510 8.0E-21
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 271 510 9.0E-21
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 343 510 9.0E-21
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 336 537 1.0E-20
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 318 510 1.0E-20
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 337 590 1.0E-20
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 310 536 1.0E-20
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 340 588 1.0E-20
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 248 510 1.0E-20
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 248 510 1.0E-20
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 248 510 1.0E-20
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 274 510 1.0E-20
sp|O02827|MYLK_SHEEP Myosin light chain kinase, smooth muscle (Fragment) OS=Ovis aries GN=MYLK PE=2 SV=1 339 588 1.0E-20
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 277 564 1.0E-20
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 339 588 1.0E-20
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 311 514 1.0E-20
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 310 540 1.0E-20
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 319 510 1.0E-20
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 310 540 1.0E-20
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 268 510 1.0E-20
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 248 510 1.0E-20
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 311 514 2.0E-20
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 277 510 2.0E-20
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 277 510 2.0E-20
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 277 511 2.0E-20
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 311 514 2.0E-20
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 271 511 2.0E-20
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 268 510 2.0E-20
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 339 588 2.0E-20
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 268 510 2.0E-20
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 271 510 2.0E-20
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 277 510 2.0E-20
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 248 510 2.0E-20
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 271 510 2.0E-20
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 248 510 2.0E-20
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 271 511 2.0E-20
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 258 537 3.0E-20
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 271 588 3.0E-20
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 277 510 3.0E-20
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 271 510 3.0E-20
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 343 591 3.0E-20
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 277 537 3.0E-20
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 277 564 3.0E-20
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 258 510 4.0E-20
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 337 590 4.0E-20
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 268 510 4.0E-20
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 268 510 4.0E-20
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 315 547 4.0E-20
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 259 510 4.0E-20
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 316 533 5.0E-20
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 277 564 5.0E-20
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 261 511 5.0E-20
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 277 510 5.0E-20
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 340 511 6.0E-20
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 243 510 7.0E-20
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 337 590 7.0E-20
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 268 511 8.0E-20
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 339 510 8.0E-20
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 277 510 9.0E-20
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 340 530 1.0E-19
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 271 511 1.0E-19
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 277 553 1.0E-19
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 339 533 1.0E-19
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 337 590 2.0E-19
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 277 510 2.0E-19
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 328 589 2.0E-19
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 277 510 2.0E-19
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 267 522 2.0E-19
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 310 534 2.0E-19
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 277 589 2.0E-19
sp|Q86V86|PIM3_HUMAN Serine/threonine-protein kinase pim-3 OS=Homo sapiens GN=PIM3 PE=1 SV=3 315 511 2.0E-19
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 277 510 2.0E-19
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 271 514 2.0E-19
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 343 513 2.0E-19
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 277 589 2.0E-19
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 277 510 2.0E-19
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 343 588 2.0E-19
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 271 531 2.0E-19
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 271 511 2.0E-19
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 277 592 3.0E-19
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 337 510 3.0E-19
sp|A7F0W2|ATG1_SCLS1 Serine/threonine-protein kinase ATG1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ATG1 PE=3 SV=1 287 510 3.0E-19
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 267 531 3.0E-19
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 311 537 3.0E-19
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 337 510 3.0E-19
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 274 510 3.0E-19
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 268 510 3.0E-19
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 268 511 4.0E-19
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 277 510 4.0E-19
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 343 510 4.0E-19
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 270 511 4.0E-19
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 336 514 5.0E-19
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 336 514 5.0E-19
sp|O70444|PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus GN=Pim3 PE=1 SV=3 312 511 5.0E-19
sp|P58750|PIM3_MOUSE Serine/threonine-protein kinase pim-3 OS=Mus musculus GN=Pim3 PE=1 SV=1 315 511 5.0E-19
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 304 510 5.0E-19
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 271 510 6.0E-19
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 351 511 6.0E-19
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 334 510 6.0E-19
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 310 510 6.0E-19
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 268 511 7.0E-19
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 310 510 7.0E-19
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 267 531 8.0E-19
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 326 588 8.0E-19
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 268 510 8.0E-19
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 267 531 8.0E-19
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 270 511 8.0E-19
sp|Q9XUJ7|DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans GN=dkf-1 PE=1 SV=1 307 511 8.0E-19
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 337 510 9.0E-19
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 314 510 9.0E-19
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 337 588 9.0E-19
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 267 531 9.0E-19
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 270 528 9.0E-19
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 311 510 1.0E-18
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 335 510 1.0E-18
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 314 510 1.0E-18
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 267 531 1.0E-18
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 270 511 1.0E-18
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 270 511 1.0E-18
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 277 531 1.0E-18
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 337 510 1.0E-18
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 337 510 1.0E-18
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 260 510 1.0E-18
sp|Q2H6X2|ATG1_CHAGB Serine/threonine-protein kinase ATG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG1 PE=3 SV=1 308 510 2.0E-18
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 337 510 2.0E-18
sp|A2QIL5|ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg1 PE=3 SV=1 335 510 2.0E-18
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 328 589 2.0E-18
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 268 511 2.0E-18
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 220 511 2.0E-18
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 268 510 2.0E-18
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 343 590 2.0E-18
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 337 510 2.0E-18
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 277 510 2.0E-18
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 271 510 2.0E-18
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 227 511 2.0E-18
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 337 510 2.0E-18
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 204 532 2.0E-18
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 319 510 2.0E-18
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 340 588 2.0E-18
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 271 510 2.0E-18
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 348 511 2.0E-18
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 275 608 2.0E-18
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 348 511 3.0E-18
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 268 511 3.0E-18
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 268 511 3.0E-18
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 328 510 3.0E-18
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 328 510 3.0E-18
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 260 510 3.0E-18
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 319 510 3.0E-18
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 270 510 3.0E-18
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 277 510 3.0E-18
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 277 511 3.0E-18
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 307 511 3.0E-18
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 292 510 3.0E-18
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 292 510 3.0E-18
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 334 510 3.0E-18
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 268 510 4.0E-18
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 341 511 4.0E-18
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 252 510 4.0E-18
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 318 510 4.0E-18
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 315 511 5.0E-18
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 235 510 5.0E-18
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 274 510 5.0E-18
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 326 588 5.0E-18
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 318 588 6.0E-18
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 277 510 6.0E-18
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 271 511 6.0E-18
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 277 510 6.0E-18
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 277 510 7.0E-18
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 277 510 7.0E-18
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 336 514 7.0E-18
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 258 531 7.0E-18
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 277 510 8.0E-18
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 341 510 8.0E-18
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 341 510 8.0E-18
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 340 588 8.0E-18
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 341 510 8.0E-18
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 277 510 9.0E-18
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 340 538 9.0E-18
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 242 511 1.0E-17
sp|Q2UGZ7|ATG1_ASPOR Serine/threonine-protein kinase atg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg1 PE=3 SV=1 334 510 1.0E-17
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 318 511 1.0E-17
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 242 511 1.0E-17
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 341 510 1.0E-17
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 268 511 1.0E-17
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 341 510 1.0E-17
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 342 588 1.0E-17
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 277 510 1.0E-17
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 335 522 1.0E-17
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 277 510 1.0E-17
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 318 510 1.0E-17
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 277 588 1.0E-17
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 342 588 1.0E-17
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 242 511 2.0E-17
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 277 511 2.0E-17
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 311 510 2.0E-17
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 277 510 2.0E-17
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 311 510 2.0E-17
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 263 514 2.0E-17
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 258 531 2.0E-17
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 258 531 2.0E-17
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 258 531 2.0E-17
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 258 531 2.0E-17
sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase apg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-1 PE=3 SV=2 277 510 2.0E-17
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 217 510 2.0E-17
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 258 531 2.0E-17
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 277 510 2.0E-17
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 239 510 2.0E-17
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 343 515 2.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 346 515 2.0E-14
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 322 510 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2651
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6599
Ophiocordyceps australis map64 (Brazil) OphauB2|1420
Ophiocordyceps camponoti-floridani Ophcf2|02231
Ophiocordyceps camponoti-rufipedis Ophun1|4888 (this protein)
Ophiocordyceps kimflemingae Ophio5|5768
Ophiocordyceps subramaniannii Hirsu2|4069

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4888
MGDDAGSSSTSAFDPSLGRDPPHHVVRLGFATPLRISTEHHAVAAHGPGLSPSLIPAHNSNGSLRPLSRTPSIRS
VATHGLGSATGNSSALPSPIITAMGNMTPLPSPLLSGDSPGPWRKLSIGSGSPPMDRGTANSGSVDSVKRKLYTT
VDNANPAPHPLSHEQQPAQGSHQRNRSVSDYTPETSTTPKRSITVSGSHIKLDTTGADETHMRRELNFADSRGLT
PTVTQPPTPPPSESSKDSIDGGKPKDVQGCEYFDARARADGKMRRWRSIGYLGQGTFSRVMLATSQLTPNEHDAA
ARPATPASERHVDRKKLVAVKVCEHGPRGGSSEERVEMSLKRELEILQGIHHPSLVHLLAWRIEPTRAILVLTYS
PGGDLFEVATAHRDALTSPLLRRIFAELVGAVRYLHEQRIVHRDIKLENVLVNLEAAQLMDSSTDWATFPQSVVT
LTDLGLSRRISDGELLETRCGSDDYAAPEVIMGQPYDGRATDAWSLGVLLYALLEARLPFDPHPGMSDAHRMRSR
TSHRIARVEWRWVEYGGDEGDHEADLAKFERRGLIGAMEVTEGLLKRARSRWSVDQVAVQPWVRDAIRVDGGLRF
WEAENGKEV*
Coding >Ophun1|4888
ATGGGCGACGATGCCGGCTCCTCGTCAACCTCCGCTTTCGATCCTTCACTCGGCCGCGATCCGCCGCATCACGTC
GTCCGTCTCGGCTTCGCTACGCCGCTCCGCATCTCCACCGAGCACCATGCCGTCGCCGCTCACGGGCCCGGCCTC
TCTCCGTCCCTGATACCCGCTCACAACTCCAACGGCAGCCTGCGTCCGCTCTCGAGGACGCCCAGCATCCGATCC
GTCGCTACCCACGGCCTCGGCTCCGCAACGGGCAATAGCAGCGCCTTACCGAGTCCCATCATCACCGCCATGGGC
AACATGACGCCGCTACCGAGCCCCCTGCTGTCCGGCGACTCCCCGGGCCCCTGGCGGAAGCTCAGCATCGGCTCA
GGCTCCCCGCCCATGGACCGTGGCACCGCCAACAGCGGCTCGGTCGATTCCGTCAAGCGCAAGCTGTACACAACC
GTTGACAATGCCAACCCCGCCCCTCATCCTCTGTCCCACGAACAGCAACCCGCCCAGGGCTCCCATCAAAGGAAC
CGCAGCGTCAGCGACTACACGCCCGAGACGTCCACTACTCCCAAGCGGTCCATCACTGTCTCTGGCTCCCACATC
AAACTCGACACGACGGGCGCCGACGAGACACACATGCGGAGAGAGCTCAACTTTGCCGACTCGCGAGGCTTGACG
CCGACCGTCACACAGCCCCCAACTCCTCCACCTAGCGAGTCATCCAAGGATTCCATCGACGGCGGCAAGCCCAAA
GATGTCCAGGGTTGCGAGTATTTCGACGCACGCGCACGCGCCGACGGTAAGATGCGACGCTGGAGGTCCATTGGT
TATCTTGGCCAGGGTACCTTTAGCCGAGTTATGCTGGCGACCAGCCAACTGACGCCCAACGAGCACGATGCAGCA
GCACGGCCCGCGACCCCGGCGTCGGAGCGCCACGTTGATAGGAAGAAGCTGGTCGCCGTCAAGGTGTGCGAGCAT
GGCCCACGCGGAGGCTCTTCCGAGGAGCGGGTCGAGATGAGCCTGAAGCGGGAGCTCGAGATTCTGCAGGGTATC
CATCACCCGTCGCTGGTGCATCTGCTGGCCTGGCGCATAGAGCCGACCAGGGCCATTCTCGTCTTGACCTACTCT
CCCGGAGGGGACCTTTTCGAGGTGGCGACGGCTCATCGAGATGCCCTGACATCCCCGCTGCTGAGGAGGATCTTT
GCTGAGCTCGTTGGCGCTGTGCGCTATCTACACGAGCAGAGAATCGTTCATCGCGACATCAAGCTCGAGAACGTG
CTGGTCAACCTAGAAGCTGCCCAACTGATGGATTCATCTACGGATTGGGCGACATTTCCCCAGTCTGTGGTGACG
CTGACGGATCTCGGTCTATCGCGACGTATCTCGGATGGAGAGCTTCTGGAAACGCGGTGCGGCTCAGACGATTAC
GCGGCCCCCGAGGTCATCATGGGTCAGCCGTACGACGGCCGAGCCACGGATGCCTGGTCGTTGGGCGTGCTTCTC
TATGCCTTACTCGAGGCTCGTCTACCCTTTGATCCGCACCCAGGCATGAGTGACGCGCACCGCATGCGCAGCCGC
ACCAGTCACCGGATAGCGAGGGTAGAGTGGCGATGGGTCGAGTACGGCGGTGACGAGGGCGATCACGAGGCCGAC
TTGGCCAAGTTTGAGAGACGAGGCCTCATTGGCGCCATGGAGGTCACAGAAGGCCTCCTCAAGCGAGCACGCAGC
CGATGGAGCGTCGACCAGGTGGCGGTCCAGCCGTGGGTACGGGATGCCATCCGCGTCGACGGCGGACTGCGATTC
TGGGAAGCGGAGAACGGAAAGGAAGTTTGA
Transcript >Ophun1|4888
ATGGGCGACGATGCCGGCTCCTCGTCAACCTCCGCTTTCGATCCTTCACTCGGCCGCGATCCGCCGCATCACGTC
GTCCGTCTCGGCTTCGCTACGCCGCTCCGCATCTCCACCGAGCACCATGCCGTCGCCGCTCACGGGCCCGGCCTC
TCTCCGTCCCTGATACCCGCTCACAACTCCAACGGCAGCCTGCGTCCGCTCTCGAGGACGCCCAGCATCCGATCC
GTCGCTACCCACGGCCTCGGCTCCGCAACGGGCAATAGCAGCGCCTTACCGAGTCCCATCATCACCGCCATGGGC
AACATGACGCCGCTACCGAGCCCCCTGCTGTCCGGCGACTCCCCGGGCCCCTGGCGGAAGCTCAGCATCGGCTCA
GGCTCCCCGCCCATGGACCGTGGCACCGCCAACAGCGGCTCGGTCGATTCCGTCAAGCGCAAGCTGTACACAACC
GTTGACAATGCCAACCCCGCCCCTCATCCTCTGTCCCACGAACAGCAACCCGCCCAGGGCTCCCATCAAAGGAAC
CGCAGCGTCAGCGACTACACGCCCGAGACGTCCACTACTCCCAAGCGGTCCATCACTGTCTCTGGCTCCCACATC
AAACTCGACACGACGGGCGCCGACGAGACACACATGCGGAGAGAGCTCAACTTTGCCGACTCGCGAGGCTTGACG
CCGACCGTCACACAGCCCCCAACTCCTCCACCTAGCGAGTCATCCAAGGATTCCATCGACGGCGGCAAGCCCAAA
GATGTCCAGGGTTGCGAGTATTTCGACGCACGCGCACGCGCCGACGGTAAGATGCGACGCTGGAGGTCCATTGGT
TATCTTGGCCAGGGTACCTTTAGCCGAGTTATGCTGGCGACCAGCCAACTGACGCCCAACGAGCACGATGCAGCA
GCACGGCCCGCGACCCCGGCGTCGGAGCGCCACGTTGATAGGAAGAAGCTGGTCGCCGTCAAGGTGTGCGAGCAT
GGCCCACGCGGAGGCTCTTCCGAGGAGCGGGTCGAGATGAGCCTGAAGCGGGAGCTCGAGATTCTGCAGGGTATC
CATCACCCGTCGCTGGTGCATCTGCTGGCCTGGCGCATAGAGCCGACCAGGGCCATTCTCGTCTTGACCTACTCT
CCCGGAGGGGACCTTTTCGAGGTGGCGACGGCTCATCGAGATGCCCTGACATCCCCGCTGCTGAGGAGGATCTTT
GCTGAGCTCGTTGGCGCTGTGCGCTATCTACACGAGCAGAGAATCGTTCATCGCGACATCAAGCTCGAGAACGTG
CTGGTCAACCTAGAAGCTGCCCAACTGATGGATTCATCTACGGATTGGGCGACATTTCCCCAGTCTGTGGTGACG
CTGACGGATCTCGGTCTATCGCGACGTATCTCGGATGGAGAGCTTCTGGAAACGCGGTGCGGCTCAGACGATTAC
GCGGCCCCCGAGGTCATCATGGGTCAGCCGTACGACGGCCGAGCCACGGATGCCTGGTCGTTGGGCGTGCTTCTC
TATGCCTTACTCGAGGCTCGTCTACCCTTTGATCCGCACCCAGGCATGAGTGACGCGCACCGCATGCGCAGCCGC
ACCAGTCACCGGATAGCGAGGGTAGAGTGGCGATGGGTCGAGTACGGCGGTGACGAGGGCGATCACGAGGCCGAC
TTGGCCAAGTTTGAGAGACGAGGCCTCATTGGCGCCATGGAGGTCACAGAAGGCCTCCTCAAGCGAGCACGCAGC
CGATGGAGCGTCGACCAGGTGGCGGTCCAGCCGTGGGTACGGGATGCCATCCGCGTCGACGGCGGACTGCGATTC
TGGGAAGCGGAGAACGGAAAGGAAGTTTGA
Gene >Ophun1|4888
ATGGGCGACGATGCCGGCTCCTCGTCAACCTCCGCTTTCGATCCTTCACTCGGCCGCGATCCGCCGCATCACGTC
GTCCGTCTCGGCTTCGCTACGCCGCTCCGCATCTCCACCGAGCACCATGCCGTCGCCGCTCACGGGCCCGGCCTC
TCTCCGTCCCTGATACCCGCTCACAACTCCAACGGCAGCCTGCGTCCGCTCTCGAGGACGCCCAGCATCCGATCC
GTCGCTACCCACGGCCTCGGCTCCGCAACGGGCAATAGCAGCGCCTTACCGAGTCCCATCATCACCGCCATGGGC
AACATGACGCCGCTACCGAGCCCCCTGCTGTCCGGCGACTCCCCGGGCCCCTGGCGGAAGCTCAGCATCGGCTCA
GGCTCCCCGCCCATGGACCGTGGCACCGCCAACAGCGGCTCGGTCGATTCCGTCAAGCGCAAGCTGTACACAACC
GTTGACAATGCCAACCCCGCCCCTCATCCTCTGTCCCACGAACAGCAACCCGCCCAGGGCTCCCATCAAAGGAAC
CGCAGCGTCAGCGACTACACGCCCGAGACGTCCACTACTCCCAAGCGGTCCATCACTGTCTCTGGCTCCCACATC
AAACTCGACACGACGGGCGCCGACGAGACACACATGCGGAGAGAGCTCAACTTTGCCGACTCGCGAGGCTTGACG
CCGACCGTCACACAGCCCCCAACTCCTCCACCTAGCGAGTCATCCAAGGATTCCATCGACGGCGGCAAGCCCAAA
GATGTCCAGGGTTGCGAGTATTTCGACGCACGCGCACGCGCCGACGGTAAGATGCGACGCTGGAGGTCCATTGGT
TATCTTGGCCAGGGTACCTTTAGCCGAGTTATGCTGGCGACCAGCCAACTGACGCCCAACGAGCACGATGCAGCA
GCACGGCCCGCGACCCCGGCGTCGGAGCGCCACGTTGATAGGAAGAAGCTGGTCGCCGTCAAGGTGTGCGAGCAT
GGCCCACGCGGAGGCTCTTCCGAGGAGCGGGTCGAGATGAGCCTGAAGCGGGAGCTCGAGATTCTGCAGGGTATC
CATCACCCGTCGCTGGTGCATCTGCTGGCCTGGCGCATAGAGCCGACCAGGGCCATTCTCGTCTTGACCTACTCT
CCCGGAGGGGACCTTTTCGAGGTGGCGACGGCTCATCGAGATGCCCTGACATCCCCGCTGCTGAGGAGGATCTTT
GCTGAGCTCGTTGGCGCTGTGCGCTATCTACACGAGCAGAGAATCGTTCATCGCGACATCAAGCTCGAGAGTGAG
CTTGGCTTCTCCCCTGAACATGGAAACCTTGTTTGCTAACCCGAGTGCTACCACAAGACGTGCTGGTCAACCTAG
AAGCTGCCCAACTGATGGATTCATCTACGGATTGGGCGACATTTCCCCAGTCTGTGGTGACGCTGACGGATCTCG
GTCTATCGCGACGTATCTCGGATGGAGAGCTTCTGGAAACGCGGTGCGGCTCAGACGATTACGCGGCCCCCGAGG
TCATCATGGGTCAGCCGTACGACGGCCGAGCCACGGATGCCTGGTCGTTGGGCGTGCTTCTCTATGCCTTACTCG
AGGCTCGTCTACCCTTTGATCCGCACCCAGGCATGAGTGACGCGCACCGCATGCGCAGCCGCACCAGTCACCGGA
TAGCGAGGGTAGAGTGGCGATGGGTCGAGTACGGCGGTGACGAGGGCGATCACGAGGCCGACTTGGCCAAGTTTG
AGAGACGAGGCCTCATTGGCGCCATGGAGGTCACAGAAGGCCTCCTCAAGCGAGCACGCAGCCGATGGAGCGTCG
ACCAGGTGGCGGTCCAGCCGTGGGTACGGGATGCCATCCGCGTCGACGGCGGACTGCGATTCTGGGAAGCGGAGA
ACGGAAAGGAAGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail