Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4871
Gene name
LocationContig_46:33402..33975
Strand-
Gene length (bp)573
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02290 SRP14 Signal recognition particle 14kD protein 5.1E-30 7 111

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P372|SRP14_SCHPO Signal recognition particle subunit srp14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp14 PE=1 SV=1 7 111 1.0E-06

GO

GO Term Description Terminal node
GO:0008312 7S RNA binding Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0005786 signal recognition particle, endoplasmic reticulum targeting Yes
GO:0030942 endoplasmic reticulum signal peptide binding Yes
GO:0070972 protein localization to endoplasmic reticulum No
GO:0071705 nitrogen compound transport No
GO:0006612 protein targeting to membrane No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:0051649 establishment of localization in cell No
GO:0005048 signal sequence binding No
GO:0006613 cotranslational protein targeting to membrane No
GO:0033218 amide binding No
GO:0032991 protein-containing complex No
GO:0097159 organic cyclic compound binding No
GO:0033036 macromolecule localization No
GO:0051234 establishment of localization No
GO:0042277 peptide binding No
GO:0046907 intracellular transport No
GO:0045047 protein targeting to ER No
GO:0090150 establishment of protein localization to membrane No
GO:0008104 protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:1901363 heterocyclic compound binding No
GO:0006886 intracellular protein transport No
GO:0071702 organic substance transport No
GO:0051668 localization within membrane No
GO:0051641 cellular localization No
GO:0048500 signal recognition particle No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0072657 protein localization to membrane No
GO:1990904 ribonucleoprotein complex No
GO:0033365 protein localization to organelle No
GO:0045184 establishment of protein localization No
GO:0006605 protein targeting No
GO:0003674 molecular_function No
GO:0003723 RNA binding No
GO:0015031 protein transport No
GO:0005575 cellular_component No
GO:0070727 cellular macromolecule localization No
GO:0072594 establishment of protein localization to organelle No
GO:0051179 localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5085
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2123
Ophiocordyceps australis map64 (Brazil) OphauB2|4964
Ophiocordyceps camponoti-floridani Ophcf2|03247
Ophiocordyceps camponoti-rufipedis Ophun1|4871 (this protein)
Ophiocordyceps kimflemingae Ophio5|69
Ophiocordyceps subramaniannii Hirsu2|2992

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4871
MKESRHLSHDEFFDGLSELLDLRKGSDHGAIYLTQKRFSYQQEQGEPTTATDDFPSQDLTLAPVLIRATDGNSRV
KGSRQKVKLSTLVEPSALEAFYLRYAEVCKAGMTALKPRDRSKKKAKARKKKAVS*
Coding >Ophun1|4871
ATGAAAGAATCGCGGCACTTGAGTCACGATGAGTTCTTCGACGGCTTGAGCGAGCTCCTCGACCTCCGCAAAGGC
AGCGACCACGGAGCCATCTACCTCACTCAGAAGCGCTTCAGCTACCAACAAGAACAAGGCGAGCCCACAACAGCG
ACAGACGATTTCCCTAGCCAAGACTTAACGCTCGCTCCCGTCCTCATCCGCGCAACCGACGGAAATTCGAGAGTG
AAGGGAAGTCGCCAAAAGGTCAAGCTGTCTACACTCGTGGAGCCCTCTGCCCTTGAGGCGTTTTATCTGCGGTAT
GCCGAGGTATGCAAAGCCGGCATGACGGCTCTCAAGCCCAGGGACCGCAGTAAGAAGAAGGCAAAGGCACGAAAG
AAGAAGGCTGTGTCATGA
Transcript >Ophun1|4871
ATGAAAGAATCGCGGCACTTGAGTCACGATGAGTTCTTCGACGGCTTGAGCGAGCTCCTCGACCTCCGCAAAGGC
AGCGACCACGGAGCCATCTACCTCACTCAGAAGCGCTTCAGCTACCAACAAGAACAAGGCGAGCCCACAACAGCG
ACAGACGATTTCCCTAGCCAAGACTTAACGCTCGCTCCCGTCCTCATCCGCGCAACCGACGGAAATTCGAGAGTG
AAGGGAAGTCGCCAAAAGGTCAAGCTGTCTACACTCGTGGAGCCCTCTGCCCTTGAGGCGTTTTATCTGCGGTAT
GCCGAGGTATGCAAAGCCGGCATGACGGCTCTCAAGCCCAGGGACCGCAGTAAGAAGAAGGCAAAGGCACGAAAG
AAGAAGGCTGTGTCATGA
Gene >Ophun1|4871
ATGAAAGAATCGCGGCACTTGAGTCACGATGAGGTGAGTTGAATACTCCTAGAGCAGCAAGTCAAGGAATCATTA
CTCAAGCGTTCGCTGTCTAGTTCTTCGACGGCTTGAGCGAGCTCCTCGACCTCCGCAAAGGCAGCGACCACGGAG
CCATCTACCTCACTCAGAAGCGCTGTGCGTCAATTTTCCGGAACTAGAGGTGGCTGATGTTATCTCGTCATCAAT
TTGACGTGGCGATTGGAGTTGCGAAAGATAGAGAGAGAGAGAGAGAGCTGACCACTTGGTCCCGCAGTCAGCTAC
CAACAAGAACAAGGCGAGCCCACAACAGCGACAGACGATTTCCCTAGCCAAGACTTAACGCTCGCTCCCGTCCTC
ATCCGCGCAACCGACGGAAATTCGAGAGTGAAGGGAAGTCGCCAAAAGGTCAAGCTGTCTACACTCGTGGAGCCC
TCTGCCCTTGAGGCGTTTTATCTGCGGTATGCCGAGGTATGCAAAGCCGGCATGACGGCTCTCAAGCCCAGGGAC
CGCAGTAAGAAGAAGGCAAAGGCACGAAAGAAGAAGGCTGTGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail