Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4868
Gene name
LocationContig_46:23392..27223
Strand+
Gene length (bp)3831
Transcript length (bp)3552
Coding sequence length (bp)3552
Protein length (aa) 1184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 9.3E-11 142 259
PF02463 SMC_N RecF/RecN/SMC N terminal domain 1.1E-10 870 1155
PF13476 AAA_23 AAA domain 1.5E-11 144 371
PF13175 AAA_15 AAA ATPase domain 8.3E-09 142 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 126 1174 2.0E-132
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 86 1156 1.0E-116
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 128 1175 9.0E-116
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 128 1175 2.0E-115
sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein 6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1 138 1174 2.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 126 1174 2.0E-132
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 86 1156 1.0E-116
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 128 1175 9.0E-116
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 128 1175 2.0E-115
sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein 6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1 138 1174 2.0E-105
sp|Q802R8|SMC6_TAKRU Structural maintenance of chromosomes protein 6 OS=Takifugu rubripes GN=smc6 PE=2 SV=1 136 1159 7.0E-101
sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 95 1166 2.0E-88
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 132 1159 7.0E-74
sp|Q9FLR5|SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana GN=SMC6A PE=2 SV=1 139 711 2.0E-53
sp|Q9LFS8|SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana GN=SMC5 PE=2 SV=1 140 298 4.0E-11
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 140 290 2.0E-10
sp|Q802R9|SMC5_TAKRU Structural maintenance of chromosomes protein 5 OS=Takifugu rubripes GN=smc5 PE=2 SV=1 140 290 3.0E-10
sp|Q08204|SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC5 PE=1 SV=1 138 290 4.0E-10
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 140 290 8.0E-10
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 140 290 3.0E-09
sp|Q805A1|SMC5_XENLA Structural maintenance of chromosomes protein 5 OS=Xenopus laevis GN=smc5 PE=2 SV=1 140 277 2.0E-07
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 140 290 3.0E-07
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 934 1167 4.0E-07
sp|Q9LFS8|SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana GN=SMC5 PE=2 SV=1 1035 1159 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140664 ATP-dependent DNA damage sensor activity Yes
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140612 DNA damage sensor activity No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0003824 catalytic activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0140299 small molecule sensor activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5072
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|807
Ophiocordyceps australis map64 (Brazil) OphauB2|4674
Ophiocordyceps camponoti-floridani Ophcf2|03244
Ophiocordyceps camponoti-rufipedis Ophun1|4868 (this protein)
Ophiocordyceps kimflemingae Ophio5|72
Ophiocordyceps subramaniannii Hirsu2|2891

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4868
MASRKRGRRSVADDDDDSDNGEVSEVQEPRSSHRSNAQPASRLDISYFPNQSNAILQRKRVRVSLEDPPSSPNDD
SSSSEDEELGDVPNDNDAIPQTQYELMRDAGFEHLQNIEMDDRWAEKKLERRTTVTSDNMVAESGIIESITCINF
MCHERLHVELGPLINFIVGENGSGKSAVLTALTLCLGGKASDTNRGGSLKSFVKEGQDHGRLIVKIKNVGSDAYQ
HDVYGDSIIVERHFSKSGSSGFKIKNDRQQTISIKKQEVDEITEWYAMQMGNPLTVLSQDNARQFLNSATPAQKY
KYFISGVQLEQLDNDYKMSQDTLDKTLLLRDDLNDKNELVKRNMEEAQRLADTVQKNIGLREKARHYRKQLVWAQ
VVKQERMLEGLDKDLAARDEAIVRTEADCEAKSKALDECQVKLEGAQASRQKVLDDAESIKENTSAADSVYQAAK
KELTDLHREERDAYAHLRTVTREIETCEAKIRDEELRLYNSTGSARAEKDAELSEVKAREKQLQEEIEETKRKLP
ELRSLDAEADLALKNRQQAKSSKREDILKAEQGVRALKESTGSAMDGFDPQMTTLLKAIAEDNGFSQKPIGPLGA
HIKLLKPEWSGILEKTFGEALNAFAVKSKQDQTRLLGLMRRIRMRKLPPIYIAYLGKIDTRGNEPDSKFDTILRV
LEFDDDIIRSQLIINNRIEKVILVKERVEAERIMFDEGPPRNVLACLCFHDGRTRRGQGLRLTSRAGSMSTSPVI
PIVSRHPRMQSDSARQLSLQKDNLRQLGLELRDINVEERSAQQVKQRCASDIVENQARQKELYNKLRRTQADVER
LQGELDAFEGVDDRLIALRSELEAKRSEESALGSQYGNMRLLKHELSEKSDEAKKALDAERLKEKDFENRVTKAD
VKIKSCESLRQVAVSEKNVAIERLDIAKSERRRAQEKRDEQVQNVQKIIEEAEKMMPERVHIPEDETHDSIEKKY
ATIVKQLAQRQAKMGATDEEIYDRAKDARTEYEEVVKQTRHVDETIKSLQSAIEQRLHLWRQFQRQISARVRIQF
NYLLSERGFRGKIDLDHRSRKVVIHIEPDETRRSSSGRSTKTLSGGEKSFSSICMLLSVWEAIGSPIRCLDEFDV
FMDNVNRAISTNMLVDAARRSVSRQYILITPNAIEGRAKLDKDVKIIRILPSGPGQNI*
Coding >Ophun1|4868
ATGGCCTCACGGAAGCGTGGCCGACGGTCAGTCGCCGATGATGACGACGATAGCGACAACGGAGAGGTCTCCGAA
GTGCAAGAACCGCGCTCGTCGCATCGAAGCAATGCACAGCCGGCGAGTCGCCTTGATATCTCATATTTCCCAAAC
CAATCTAATGCAATACTTCAGAGAAAACGGGTACGGGTCTCACTCGAGGACCCGCCTTCCTCCCCAAACGATGAC
TCCTCGAGTTCCGAAGATGAAGAACTGGGCGATGTGCCAAACGACAACGATGCCATTCCTCAGACGCAGTACGAG
CTTATGCGAGACGCTGGGTTCGAGCATCTGCAAAACATCGAGATGGACGATCGTTGGGCCGAGAAGAAGTTGGAG
AGGAGGACGACGGTCACTAGCGACAACATGGTGGCCGAAAGTGGAATCATCGAGAGCATCACATGCATCAACTTC
ATGTGTCACGAGCGCCTACATGTCGAATTAGGTCCGCTCATCAACTTCATTGTCGGCGAGAATGGCAGTGGCAAG
AGTGCGGTCCTGACTGCCTTGACTCTATGTCTTGGTGGTAAGGCTAGCGACACCAACCGAGGAGGAAGCCTCAAG
TCTTTCGTGAAAGAGGGCCAAGATCATGGAAGGCTCATCGTCAAGATCAAGAACGTCGGCTCTGATGCCTACCAG
CATGATGTTTATGGCGACAGCATCATTGTCGAGCGACATTTCTCAAAATCCGGCAGCAGCGGCTTCAAGATCAAG
AATGATCGCCAACAGACGATCTCAATCAAGAAGCAGGAGGTGGACGAGATAACGGAGTGGTATGCCATGCAGATG
GGAAATCCCCTGACGGTCCTCTCCCAGGACAACGCTAGGCAGTTTCTCAACTCTGCAACTCCCGCGCAGAAATAC
AAGTACTTCATCTCTGGGGTGCAACTGGAGCAGCTGGACAACGATTACAAGATGTCCCAAGACACGCTCGACAAA
ACTCTTCTTCTACGGGATGACCTGAATGACAAGAATGAACTCGTCAAGAGAAACATGGAGGAGGCTCAGAGACTT
GCTGATACGGTGCAGAAGAACATTGGTCTTCGTGAAAAAGCTAGGCACTACCGAAAGCAGCTGGTGTGGGCACAG
GTGGTTAAGCAGGAGCGAATGCTTGAGGGACTCGATAAAGATCTCGCCGCTCGAGACGAAGCCATTGTGCGAACA
GAGGCCGACTGCGAAGCCAAGAGCAAAGCCCTTGACGAGTGTCAAGTCAAGTTGGAAGGCGCCCAAGCCAGCCGC
CAGAAGGTCTTGGACGACGCAGAATCTATCAAGGAAAATACCAGCGCTGCAGACTCAGTCTATCAGGCGGCCAAG
AAGGAACTTACCGATCTCCACCGAGAGGAAAGGGATGCCTATGCCCATCTTAGGACGGTGACGAGAGAGATCGAG
ACGTGCGAGGCCAAGATCAGAGACGAGGAACTACGCCTTTACAATTCCACTGGCTCTGCCCGCGCCGAGAAGGAC
GCCGAGCTGTCCGAAGTCAAAGCTCGGGAGAAACAGCTCCAAGAGGAGATTGAGGAGACGAAAAGGAAGCTGCCC
GAGTTGCGGTCCCTCGACGCCGAGGCAGACTTAGCGCTTAAGAACCGACAGCAGGCCAAGTCCAGCAAACGTGAG
GACATTTTGAAGGCGGAACAGGGTGTCCGCGCACTGAAAGAGAGCACCGGTTCGGCCATGGACGGATTTGACCCA
CAAATGACCACTCTTCTCAAGGCTATCGCCGAAGACAACGGCTTCAGCCAGAAGCCAATCGGTCCATTGGGTGCT
CACATCAAGTTGCTCAAGCCAGAATGGTCCGGCATCCTGGAAAAAACCTTTGGAGAAGCTCTGAACGCGTTCGCC
GTCAAGTCTAAGCAGGATCAGACTCGGCTTCTCGGCTTGATGCGGCGGATCAGGATGAGGAAACTTCCTCCAATC
TACATTGCCTACCTAGGGAAGATCGACACTCGCGGCAATGAGCCGGACAGCAAGTTTGATACCATTTTGAGAGTC
CTCGAGTTCGACGACGACATCATTCGATCGCAGTTGATCATCAATAACCGCATCGAAAAAGTGATTCTCGTCAAG
GAACGCGTTGAAGCTGAGCGAATAATGTTTGATGAAGGCCCTCCGCGTAACGTCCTGGCATGTCTCTGCTTTCAC
GACGGCAGAACAAGACGAGGTCAAGGCCTGCGCCTGACGAGCCGAGCCGGCTCCATGTCAACGAGTCCCGTCATT
CCGATCGTTTCACGGCATCCGAGGATGCAGTCCGACTCGGCCAGACAACTGTCGTTGCAAAAGGACAACTTGAGG
CAGCTGGGCCTGGAGCTTCGGGACATCAACGTCGAAGAGCGCTCTGCGCAGCAAGTCAAGCAGAGGTGCGCCTCG
GATATTGTCGAAAACCAGGCGCGGCAGAAGGAGCTTTACAATAAGCTTCGGCGGACACAGGCCGATGTTGAGCGA
CTTCAAGGAGAACTAGACGCCTTCGAAGGCGTTGACGACCGCCTGATTGCTCTGCGATCCGAGTTAGAGGCAAAG
CGGTCCGAGGAATCTGCCCTCGGGAGTCAGTACGGTAACATGAGACTCTTGAAGCACGAGCTCAGCGAAAAGTCC
GATGAGGCCAAGAAGGCACTGGACGCCGAACGGCTCAAGGAGAAGGATTTTGAGAATCGGGTCACTAAGGCCGAC
GTCAAGATTAAGAGCTGCGAGTCACTGAGACAAGTCGCCGTCTCGGAAAAGAACGTGGCCATCGAGAGGCTGGAC
ATTGCCAAGAGCGAACGGCGCCGCGCGCAGGAGAAGCGCGACGAACAGGTTCAGAATGTTCAGAAGATCATCGAA
GAGGCCGAGAAAATGATGCCGGAACGAGTCCACATACCCGAGGACGAGACTCACGATAGTATCGAGAAAAAGTAT
GCCACCATCGTGAAGCAGCTCGCTCAGCGTCAGGCCAAGATGGGAGCTACTGATGAGGAGATCTACGACCGTGCC
AAGGATGCGAGGACAGAATATGAGGAGGTAGTGAAGCAGACGCGACACGTCGACGAGACCATTAAGTCGCTTCAG
AGCGCCATCGAACAGCGTCTACATCTGTGGCGCCAGTTTCAGCGGCAGATTAGCGCTCGCGTCCGCATCCAGTTC
AACTATCTCCTAAGCGAGCGCGGCTTCCGGGGGAAAATCGATCTGGACCATAGATCGAGGAAAGTTGTCATCCAC
ATCGAGCCGGACGAGACGCGCCGAAGCTCGTCGGGTCGCAGCACGAAGACGCTGTCGGGCGGCGAAAAGTCATTC
TCCTCAATCTGCATGCTGCTCTCCGTGTGGGAGGCTATCGGCTCGCCGATACGGTGCCTGGACGAGTTTGATGTC
TTCATGGACAACGTCAACCGAGCCATTAGCACCAACATGCTGGTTGACGCTGCCCGACGATCCGTCTCGAGACAG
TACATCCTGATCACGCCCAATGCCATAGAGGGTAGGGCCAAGTTGGACAAGGATGTAAAAATCATCCGCATTCTG
CCGTCGGGCCCAGGCCAGAACATTTAG
Transcript >Ophun1|4868
ATGGCCTCACGGAAGCGTGGCCGACGGTCAGTCGCCGATGATGACGACGATAGCGACAACGGAGAGGTCTCCGAA
GTGCAAGAACCGCGCTCGTCGCATCGAAGCAATGCACAGCCGGCGAGTCGCCTTGATATCTCATATTTCCCAAAC
CAATCTAATGCAATACTTCAGAGAAAACGGGTACGGGTCTCACTCGAGGACCCGCCTTCCTCCCCAAACGATGAC
TCCTCGAGTTCCGAAGATGAAGAACTGGGCGATGTGCCAAACGACAACGATGCCATTCCTCAGACGCAGTACGAG
CTTATGCGAGACGCTGGGTTCGAGCATCTGCAAAACATCGAGATGGACGATCGTTGGGCCGAGAAGAAGTTGGAG
AGGAGGACGACGGTCACTAGCGACAACATGGTGGCCGAAAGTGGAATCATCGAGAGCATCACATGCATCAACTTC
ATGTGTCACGAGCGCCTACATGTCGAATTAGGTCCGCTCATCAACTTCATTGTCGGCGAGAATGGCAGTGGCAAG
AGTGCGGTCCTGACTGCCTTGACTCTATGTCTTGGTGGTAAGGCTAGCGACACCAACCGAGGAGGAAGCCTCAAG
TCTTTCGTGAAAGAGGGCCAAGATCATGGAAGGCTCATCGTCAAGATCAAGAACGTCGGCTCTGATGCCTACCAG
CATGATGTTTATGGCGACAGCATCATTGTCGAGCGACATTTCTCAAAATCCGGCAGCAGCGGCTTCAAGATCAAG
AATGATCGCCAACAGACGATCTCAATCAAGAAGCAGGAGGTGGACGAGATAACGGAGTGGTATGCCATGCAGATG
GGAAATCCCCTGACGGTCCTCTCCCAGGACAACGCTAGGCAGTTTCTCAACTCTGCAACTCCCGCGCAGAAATAC
AAGTACTTCATCTCTGGGGTGCAACTGGAGCAGCTGGACAACGATTACAAGATGTCCCAAGACACGCTCGACAAA
ACTCTTCTTCTACGGGATGACCTGAATGACAAGAATGAACTCGTCAAGAGAAACATGGAGGAGGCTCAGAGACTT
GCTGATACGGTGCAGAAGAACATTGGTCTTCGTGAAAAAGCTAGGCACTACCGAAAGCAGCTGGTGTGGGCACAG
GTGGTTAAGCAGGAGCGAATGCTTGAGGGACTCGATAAAGATCTCGCCGCTCGAGACGAAGCCATTGTGCGAACA
GAGGCCGACTGCGAAGCCAAGAGCAAAGCCCTTGACGAGTGTCAAGTCAAGTTGGAAGGCGCCCAAGCCAGCCGC
CAGAAGGTCTTGGACGACGCAGAATCTATCAAGGAAAATACCAGCGCTGCAGACTCAGTCTATCAGGCGGCCAAG
AAGGAACTTACCGATCTCCACCGAGAGGAAAGGGATGCCTATGCCCATCTTAGGACGGTGACGAGAGAGATCGAG
ACGTGCGAGGCCAAGATCAGAGACGAGGAACTACGCCTTTACAATTCCACTGGCTCTGCCCGCGCCGAGAAGGAC
GCCGAGCTGTCCGAAGTCAAAGCTCGGGAGAAACAGCTCCAAGAGGAGATTGAGGAGACGAAAAGGAAGCTGCCC
GAGTTGCGGTCCCTCGACGCCGAGGCAGACTTAGCGCTTAAGAACCGACAGCAGGCCAAGTCCAGCAAACGTGAG
GACATTTTGAAGGCGGAACAGGGTGTCCGCGCACTGAAAGAGAGCACCGGTTCGGCCATGGACGGATTTGACCCA
CAAATGACCACTCTTCTCAAGGCTATCGCCGAAGACAACGGCTTCAGCCAGAAGCCAATCGGTCCATTGGGTGCT
CACATCAAGTTGCTCAAGCCAGAATGGTCCGGCATCCTGGAAAAAACCTTTGGAGAAGCTCTGAACGCGTTCGCC
GTCAAGTCTAAGCAGGATCAGACTCGGCTTCTCGGCTTGATGCGGCGGATCAGGATGAGGAAACTTCCTCCAATC
TACATTGCCTACCTAGGGAAGATCGACACTCGCGGCAATGAGCCGGACAGCAAGTTTGATACCATTTTGAGAGTC
CTCGAGTTCGACGACGACATCATTCGATCGCAGTTGATCATCAATAACCGCATCGAAAAAGTGATTCTCGTCAAG
GAACGCGTTGAAGCTGAGCGAATAATGTTTGATGAAGGCCCTCCGCGTAACGTCCTGGCATGTCTCTGCTTTCAC
GACGGCAGAACAAGACGAGGTCAAGGCCTGCGCCTGACGAGCCGAGCCGGCTCCATGTCAACGAGTCCCGTCATT
CCGATCGTTTCACGGCATCCGAGGATGCAGTCCGACTCGGCCAGACAACTGTCGTTGCAAAAGGACAACTTGAGG
CAGCTGGGCCTGGAGCTTCGGGACATCAACGTCGAAGAGCGCTCTGCGCAGCAAGTCAAGCAGAGGTGCGCCTCG
GATATTGTCGAAAACCAGGCGCGGCAGAAGGAGCTTTACAATAAGCTTCGGCGGACACAGGCCGATGTTGAGCGA
CTTCAAGGAGAACTAGACGCCTTCGAAGGCGTTGACGACCGCCTGATTGCTCTGCGATCCGAGTTAGAGGCAAAG
CGGTCCGAGGAATCTGCCCTCGGGAGTCAGTACGGTAACATGAGACTCTTGAAGCACGAGCTCAGCGAAAAGTCC
GATGAGGCCAAGAAGGCACTGGACGCCGAACGGCTCAAGGAGAAGGATTTTGAGAATCGGGTCACTAAGGCCGAC
GTCAAGATTAAGAGCTGCGAGTCACTGAGACAAGTCGCCGTCTCGGAAAAGAACGTGGCCATCGAGAGGCTGGAC
ATTGCCAAGAGCGAACGGCGCCGCGCGCAGGAGAAGCGCGACGAACAGGTTCAGAATGTTCAGAAGATCATCGAA
GAGGCCGAGAAAATGATGCCGGAACGAGTCCACATACCCGAGGACGAGACTCACGATAGTATCGAGAAAAAGTAT
GCCACCATCGTGAAGCAGCTCGCTCAGCGTCAGGCCAAGATGGGAGCTACTGATGAGGAGATCTACGACCGTGCC
AAGGATGCGAGGACAGAATATGAGGAGGTAGTGAAGCAGACGCGACACGTCGACGAGACCATTAAGTCGCTTCAG
AGCGCCATCGAACAGCGTCTACATCTGTGGCGCCAGTTTCAGCGGCAGATTAGCGCTCGCGTCCGCATCCAGTTC
AACTATCTCCTAAGCGAGCGCGGCTTCCGGGGGAAAATCGATCTGGACCATAGATCGAGGAAAGTTGTCATCCAC
ATCGAGCCGGACGAGACGCGCCGAAGCTCGTCGGGTCGCAGCACGAAGACGCTGTCGGGCGGCGAAAAGTCATTC
TCCTCAATCTGCATGCTGCTCTCCGTGTGGGAGGCTATCGGCTCGCCGATACGGTGCCTGGACGAGTTTGATGTC
TTCATGGACAACGTCAACCGAGCCATTAGCACCAACATGCTGGTTGACGCTGCCCGACGATCCGTCTCGAGACAG
TACATCCTGATCACGCCCAATGCCATAGAGGGTAGGGCCAAGTTGGACAAGGATGTAAAAATCATCCGCATTCTG
CCGTCGGGCCCAGGCCAGAACATTTAG
Gene >Ophun1|4868
ATGGCCTCACGGAAGCGTGGCCGACGGTCAGTCGCCGATGATGACGACGATAGCGACAACGGAGAGGTCTCCGAA
GTGCAAGAACCGCGCTCGTCGCATCGAAGCAATGCACAGCCGGCGAGTCGCCTTGATATCTCATATTTCCCAAAC
CAATCTAATGCAATACTTCAGAGAAAACGGGTACGGGTCTCACTCGAGGACCCGCCTTCCTCCCCAAACGATGAC
TCCTCGAGTTCCGAAGATGAAGAACTGGGCGATGTGCCAAACGACAACGATGCCATTCCTCAGACGCAGTACGAG
CTTATGCGAGACGCTGGGTTCGAGCATCTGCAAAACATCGAGATGGACGATCGTTGGGCCGAGAAGAAGTTGGAG
AGGAGGACGACGGTCACTAGCGACAACATGGTGGCCGAAAGTGGAATCATCGAGAGCATCACATGCATCAACTTC
ATGTGTCACGAGCGCCTACATGTCGAATTAGGTCCGCTCATCAACTTCATTGTCGGCGAGAATGGCAGTGGCAAG
AGTGCGGTCCTGACTGCCTTGACTCTATGTCTTGGTGGTAAGGCTAGCGACACCAACCGAGGAGGAAGCCTCAAG
TCTTTCGTGAAAGAGGGCCAAGATCATGGAAGGCTCATCGTCAAGATCAAGAACGTCGGCTCTGATGCCTACCAG
CATGATGTTTATGGCGACAGCATCATTGTCGAGCGACATTTCTCAAAATCCGGCAGCAGCGGCTTCAAGATCAAG
AATGATCGCCAACAGACGATCTCAATCAAGAAGCAGGAGGTGGACGAGATAACGGAGTGGTATGCCATGCAGATG
GGAAATCCCCTGACGGTCCTCTCCCAGGACAACGCTAGGCAGTTTCTCAACTCTGCAACTCCCGCGCAGAAATAC
AAGTACTTCATCTCTGGGGTGCAACTGGAGCAGCTGGACAACGATTACAAGATGTCCCAAGACACGCTCGACAAA
ACTCTTCTTCTACGGGATGACCTGAATGACAAGAATGAACTCGTCAAGAGAAACATGGAGGAGGCTCAGAGACTT
GCTGATACGGTGCAGAAGAACATTGGTCTTCGTGAAAAAGCTAGGCACTACCGAAAGCAGCTGGTGTGGGCACAG
GTGGTTAAGCAGGAGCGAATGCTTGAGGGACTCGATAAAGATCTCGCCGCTCGAGACGAAGCCATTGTGCGAACA
GAGGCCGACTGCGAAGCCAAGAGCAAAGCCCTTGACGAGTGTCAAGTCAAGTTGGAAGGCGCCCAAGCCAGCCGC
CAGAAGGTCTTGGACGACGCAGAATCTATCAAGGAAAATACCAGCGCTGCAGACTCAGTCTATCAGGCGGCCAAG
AAGGAACTTACCGATCTCCACCGAGAGGAAAGGGATGCCTATGCCCATCTTAGGACGGTGACGAGAGAGATCGAG
ACGTGCGAGGCCAAGATCAGAGACGAGGAACTACGCCTTTACAATTCCACTGGCTCTGCCCGCGCCGAGAAGGAC
GCCGAGCTGTCCGAAGTCAAAGCTCGGGAGAAACAGCTCCAAGAGGAGATTGAGGAGACGAAAAGGAAGCTGCCC
GAGTTGCGGTCCCTCGACGCCGAGGCAGACTTAGCGCTTAAGAACCGACAGCAGGCCAAGTCCAGCAAACGTGAG
GACATTTTGAAGGCGGAACAGGGTGTCCGCGCACTGAAAGAGAGCACCGGTTCGGCCATGGACGGATTTGACCCA
CAAATGACCACTCTTCTCAAGGCTATCGCCGAAGACAACGGCTTCAGCCAGAAGCCAATCGGTCCATTGGGTGCT
CACATCAAGTTGCTCAAGCCAGAATGGTCCGGCATCCTGGAAAAAACCTTTGGAGAAGCTCTGAACGCGTTCGCC
GTCAAGTCTAAGCAGGATCAGACTCGGCTTCTCGGCTTGATGCGGCGGATCAGGATGAGGAAACTTCCTCCAATC
TACATTGCCTACCTAGGGAAGATCGACACTCGCGGCAATGAGCCGGACAGCAAGTTTGATACCATTTTGAGAGTC
CTCGAGTTCGACGACGACATCATTCGATCGCAGTTGATCATCAATAACCGCATCGAAAAAGTGATTCTCGTCAAG
GAACGCGTTGAAGCTGAGCGAATAATGTTTGATGAAGGCCCTCCGCGTAACGTCCTGGCATGTCTCTGCTTTCAC
GACGGCAGAACAAGACGAGGTCAAGGCCTGCGCCTGACGAGCCGAGCCGGCTCCATGTCAACGAGTCCCGTCATT
CCGATCGTTTCACGGCATCCGAGGATGCAGTCCGACTCGGCCAGACAACTGTCGTTGCAAAAGGACAACTTGAGG
CAGCTGGGCCTGGAGCTTCGGGACATCAACGTCGAAGAGCGCTCTGCGCAGCAAGTCAAGCAGAGGTGCGCCTCG
GATATTGTCGAAAACCAGGCGCGGCAGAAGGAGCTTTACAATAAGCTTCGGCGGACACAGGCCGATGTTGAGCGA
CTTCAAGGAGAACTAGACGCCTTCGAAGGCGTTGACGACCGCCTGATTGCTCTGCGATCCGAGTTAGAGGCAAAG
CGGTCCGAGGAATCTGCCCTCGGGAGTCAGTACGGTAACATGAGACTCTTGAAGCACGAGCTCAGCGAAAAGTCC
GATGAGGCCAAGAAGGCACTGGACGCCGAACGGCTCAAGGAGAAGGATTTTGAGAATCGGGTCACTAAGGCCGAC
GTCAAGATTAAGAGCTGCGAGTCACTGAGACAAGTCGCCGTCTCGGAAAAGAACGTGGCCATCGAGAGGCTGGAC
ATTGCCAAGAGCGAACGGCGCCGCGCGCAGGAGAAGCGCGACGAACAGGTTCAGAATGTTCAGAAGATCATCGAA
GAGGCCGAGAAAATGATGCCGGAACGAGTCCACATACCCGAGGACGAGACTCACGATAGTATCGAGAAAAAGTAT
GCCACCATCGTGAAGCAGCTCGCTCAGCGTCAGGCCAAGATGGGAGCTACTGATGAGGAGATCTACGACCGTGCC
AAGGATGCGAGGACAGAATATGAGGAGGTAGTGAAGCAGACGCGACACGTCGACGAGACCATTAAGTCGCTTCAG
AGCGCCATCGAACAGCGTCTACATCTGTGGCGCCAGTTTCAGCGGCAGATTAGCGCTCGCGTCCGCATCCAGTTC
AACTATCTCCTAAGCGAGCGCGGCTTCCGGGGGAAAATCGATCTGGACCATAGATCGAGGAAAGTTGTCATCCAC
ATCGAGCCGGACGAGACGCGCCGAAGCTCGTCGGGTCGCAGCACGAAGACGCTGTCGGGCGGCGAAAAGTCATTC
TCCTCAATCTGCATGCTGCTCTCCGTGTGGGAGGCTATCGGCTCGCCGATACGGTGCCTGGACGAGTTTGATGTC
TTCATGGACAACGTCAACCGAGCCATTAGCACCAACATGCTGGTGAGTCGAACATCACAACTCTTCCCAGGCAGA
TTTCGAAGGCTGACAAGTCAATGGCTAGGTTGACGCTGCCCGACGATCCGTCTCGAGACAGTACATCCTGATCAC
GCCCAATGCCATAGAGGGTAGGGCCAAGTTGGACAAGGATGTAAAAATCATCCGGTACGTTAATTTCCCCGGTCA
AATCCGACCGACGCAGCTACTGACATGCTACATTTTCTATGCAGACTAACTGATCCCCGTCAACGCACCCTGATC
TGACCTGGGTCGAGGCCCTCAAACTCCTGTTTCGCCTCTTCTGTGGGAGTGATATGTTTTGGACGTTGGGGGAGC
TTGTGCAGTGGGTAGCTCGTTACAAGCGCACCGTCTCATATGCTTAGCATTCTGCCGTCGGGCCCAGGCCAGAAC
ATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail