Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4867
Gene name
LocationContig_46:21123..23073
Strand-
Gene length (bp)1950
Transcript length (bp)1779
Coding sequence length (bp)1779
Protein length (aa) 593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07093 SGT1 SGT1 protein 2.7E-76 32 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95905|ECD_HUMAN Protein ecdysoneless homolog OS=Homo sapiens GN=ECD PE=1 SV=1 29 587 3.0E-53
sp|Q9CS74|ECD_MOUSE Protein ecdysoneless homolog OS=Mus musculus GN=Ecd PE=1 SV=2 29 585 3.0E-51
sp|Q9US49|ECD_SCHPO Protein ecdysoneless homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt1 PE=3 SV=1 49 387 5.0E-43
sp|Q9W032|ECD_DROME Protein ecdysoneless OS=Drosophila melanogaster GN=ecd PE=1 SV=1 29 348 1.0E-34
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 49 331 5.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95905|ECD_HUMAN Protein ecdysoneless homolog OS=Homo sapiens GN=ECD PE=1 SV=1 29 587 3.0E-53
sp|Q9CS74|ECD_MOUSE Protein ecdysoneless homolog OS=Mus musculus GN=Ecd PE=1 SV=2 29 585 3.0E-51
sp|Q9US49|ECD_SCHPO Protein ecdysoneless homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt1 PE=3 SV=1 49 387 5.0E-43
sp|Q9W032|ECD_DROME Protein ecdysoneless OS=Drosophila melanogaster GN=ecd PE=1 SV=1 29 348 1.0E-34
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 49 331 5.0E-32
sp|Q54JR9|ECD_DICDI Protein ecdysoneless homolog OS=Dictyostelium discoideum GN=ecd PE=3 SV=1 54 331 7.0E-32
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 433 583 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
SGT1

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4867
MSLITEQHLSETGEGVQNEINKLTRKAPENSVEYWLFVLGSDCEDGTELEVILEAAEDLAQRLTKDYVWQRDPFR
LELRDQNGFRCLYGMSDYGDAIEDEWLIVYLLRQLTEKHGNLWVRIADDDGEFLLIEAANVLPDWLSPETDENRA
WIHDGKLLLIPRDAACPREIKSGSISLPQALDFIQSRSVELVHSPFIQEEAFYRLGKYPRHISDSTHCSLVTIPR
KLAFVLHSLPKSISPAVEYFYLRDPLSLEPIMSSSTTLQFPPQDLVTVSVRFSRVLFAQLKSQQLDPPAGWQKVM
RDAVLSAAPNDKEQLARTELGMKLTVGFEALAAAPGQDKRKVIEEVEALLQELSEKDGKMLPTDDEIGLWPESNR
NDDETWMNINYDDFEREISGQPRSAGLDGAEFGDSKDEDADDNTEESEDDEDSEFEDKVVGFDEQAFSSMMRTML
GLPETDTSAAHVHTGGQTSGQSGQRETTSLEAQEVAEIQELSNQMENELRNSGALKHDDASGDQIVTKQGGNVGE
EQDLNRQGSVVQDTEENSDVQIDYNLARNLLESFKGQAGLAGPTGNVLGMMGIRLPRDEDCRDNEDD*
Coding >Ophun1|4867
ATGAGTCTCATAACTGAACAGCATCTATCCGAGACAGGAGAGGGAGTTCAAAATGAAATTAATAAGCTGACAAGA
AAAGCACCAGAAAATAGTGTCGAATACTGGCTCTTTGTCCTCGGCAGTGATTGTGAGGATGGGACCGAGCTAGAA
GTGATTCTTGAAGCTGCAGAGGATCTGGCACAACGTCTGACCAAGGACTACGTTTGGCAACGCGATCCATTTCGA
CTTGAGTTGAGGGATCAAAACGGATTTCGATGTCTTTACGGCATGTCGGACTACGGTGATGCCATCGAGGATGAG
TGGCTTATTGTCTACTTGCTGCGGCAGCTTACTGAAAAGCATGGAAATCTTTGGGTCCGCATCGCTGATGATGAT
GGGGAGTTCTTGCTTATCGAGGCTGCCAATGTGTTGCCGGACTGGTTGAGCCCCGAGACGGACGAGAACCGCGCC
TGGATTCACGACGGCAAGCTACTTCTGATCCCGCGCGACGCAGCTTGCCCGCGTGAAATAAAGTCTGGATCCATT
TCCTTGCCGCAGGCGCTTGACTTCATCCAGTCCCGCTCCGTGGAGTTGGTTCATTCCCCCTTTATCCAGGAAGAG
GCTTTTTACAGGCTGGGCAAATATCCGAGACACATCTCTGATTCTACTCACTGCTCACTTGTCACCATACCGAGG
AAGCTCGCTTTTGTCCTTCACTCGCTTCCCAAGTCCATCTCTCCGGCGGTGGAGTACTTCTATCTCAGAGACCCT
TTATCCCTAGAACCAATAATGTCTAGTTCAACAACTCTCCAATTCCCACCTCAGGATCTTGTCACCGTGAGCGTA
CGATTCAGCAGAGTTCTTTTCGCGCAGCTCAAATCGCAACAGTTGGACCCCCCCGCAGGATGGCAGAAAGTCATG
CGGGATGCGGTGCTCTCGGCGGCGCCAAATGACAAGGAGCAACTCGCGAGGACTGAGCTTGGAATGAAGCTGACA
GTCGGTTTTGAAGCACTTGCAGCAGCCCCAGGTCAGGACAAGAGAAAAGTCATCGAGGAAGTGGAAGCCTTGCTT
CAAGAGTTGTCAGAAAAGGACGGCAAGATGCTACCTACTGACGATGAGATTGGGCTGTGGCCGGAGTCCAATCGC
AACGACGACGAAACTTGGATGAATATTAACTATGATGATTTCGAGCGCGAGATATCTGGTCAACCTCGCAGTGCT
GGTCTGGATGGCGCCGAGTTCGGAGATTCAAAGGACGAGGACGCCGACGACAACACCGAAGAGTCCGAAGATGAC
GAAGATAGCGAGTTTGAAGACAAAGTGGTTGGCTTCGACGAGCAAGCCTTCTCTTCCATGATGCGCACGATGTTG
GGTTTACCGGAAACGGATACATCTGCTGCCCACGTCCATACGGGGGGGCAGACCTCAGGGCAGTCTGGCCAAAGG
GAGACAACAAGCCTCGAGGCCCAAGAAGTCGCTGAGATCCAAGAGCTATCGAACCAGATGGAAAACGAACTCCGG
AACAGCGGCGCATTAAAACATGACGATGCAAGTGGCGATCAAATAGTCACAAAGCAAGGGGGCAACGTCGGCGAG
GAGCAAGACCTGAACCGTCAGGGTTCCGTGGTTCAAGATACCGAGGAAAACAGCGACGTCCAGATCGATTATAAT
CTGGCACGAAATCTATTGGAAAGCTTTAAGGGCCAAGCAGGTTTGGCCGGGCCAACAGGAAACGTCCTGGGCATG
ATGGGAATTCGACTGCCCCGAGACGAGGATTGCCGAGACAACGAAGATGATTAG
Transcript >Ophun1|4867
ATGAGTCTCATAACTGAACAGCATCTATCCGAGACAGGAGAGGGAGTTCAAAATGAAATTAATAAGCTGACAAGA
AAAGCACCAGAAAATAGTGTCGAATACTGGCTCTTTGTCCTCGGCAGTGATTGTGAGGATGGGACCGAGCTAGAA
GTGATTCTTGAAGCTGCAGAGGATCTGGCACAACGTCTGACCAAGGACTACGTTTGGCAACGCGATCCATTTCGA
CTTGAGTTGAGGGATCAAAACGGATTTCGATGTCTTTACGGCATGTCGGACTACGGTGATGCCATCGAGGATGAG
TGGCTTATTGTCTACTTGCTGCGGCAGCTTACTGAAAAGCATGGAAATCTTTGGGTCCGCATCGCTGATGATGAT
GGGGAGTTCTTGCTTATCGAGGCTGCCAATGTGTTGCCGGACTGGTTGAGCCCCGAGACGGACGAGAACCGCGCC
TGGATTCACGACGGCAAGCTACTTCTGATCCCGCGCGACGCAGCTTGCCCGCGTGAAATAAAGTCTGGATCCATT
TCCTTGCCGCAGGCGCTTGACTTCATCCAGTCCCGCTCCGTGGAGTTGGTTCATTCCCCCTTTATCCAGGAAGAG
GCTTTTTACAGGCTGGGCAAATATCCGAGACACATCTCTGATTCTACTCACTGCTCACTTGTCACCATACCGAGG
AAGCTCGCTTTTGTCCTTCACTCGCTTCCCAAGTCCATCTCTCCGGCGGTGGAGTACTTCTATCTCAGAGACCCT
TTATCCCTAGAACCAATAATGTCTAGTTCAACAACTCTCCAATTCCCACCTCAGGATCTTGTCACCGTGAGCGTA
CGATTCAGCAGAGTTCTTTTCGCGCAGCTCAAATCGCAACAGTTGGACCCCCCCGCAGGATGGCAGAAAGTCATG
CGGGATGCGGTGCTCTCGGCGGCGCCAAATGACAAGGAGCAACTCGCGAGGACTGAGCTTGGAATGAAGCTGACA
GTCGGTTTTGAAGCACTTGCAGCAGCCCCAGGTCAGGACAAGAGAAAAGTCATCGAGGAAGTGGAAGCCTTGCTT
CAAGAGTTGTCAGAAAAGGACGGCAAGATGCTACCTACTGACGATGAGATTGGGCTGTGGCCGGAGTCCAATCGC
AACGACGACGAAACTTGGATGAATATTAACTATGATGATTTCGAGCGCGAGATATCTGGTCAACCTCGCAGTGCT
GGTCTGGATGGCGCCGAGTTCGGAGATTCAAAGGACGAGGACGCCGACGACAACACCGAAGAGTCCGAAGATGAC
GAAGATAGCGAGTTTGAAGACAAAGTGGTTGGCTTCGACGAGCAAGCCTTCTCTTCCATGATGCGCACGATGTTG
GGTTTACCGGAAACGGATACATCTGCTGCCCACGTCCATACGGGGGGGCAGACCTCAGGGCAGTCTGGCCAAAGG
GAGACAACAAGCCTCGAGGCCCAAGAAGTCGCTGAGATCCAAGAGCTATCGAACCAGATGGAAAACGAACTCCGG
AACAGCGGCGCATTAAAACATGACGATGCAAGTGGCGATCAAATAGTCACAAAGCAAGGGGGCAACGTCGGCGAG
GAGCAAGACCTGAACCGTCAGGGTTCCGTGGTTCAAGATACCGAGGAAAACAGCGACGTCCAGATCGATTATAAT
CTGGCACGAAATCTATTGGAAAGCTTTAAGGGCCAAGCAGGTTTGGCCGGGCCAACAGGAAACGTCCTGGGCATG
ATGGGAATTCGACTGCCCCGAGACGAGGATTGCCGAGACAACGAAGATGATTAG
Gene >Ophun1|4867
ATGAGTCTCATAACTGAACAGCATCTATCCGAGACAGGAGAGGGAGTTCAAAATGAAATTAATAAGCTGACAAGA
AAAGCACCAGAAAATAGTGTCGAATACTGGCTCTTTGTCCTCGGCAGTGATTGTGAGGATGGGACCGAGCTAGAA
GTGATTCTTGAAGCTGCAGAGGATCTGGCACAACGTCTGACCAAGGACTACGTTTGGCAACGCGATCCATTTCGA
CTTGAGTTGAGGGATCAAAACGGTACGCAAGCTATTCCCAGGCCACATACTCCTCTCAGGCTGTTCAGCTGAGCG
GCGAGCTGAACATTCTTGAAAGGATTTCGATGTCTTTACGGCATGTCGGACTACGGTGATGCCATCGAGGATGAG
TGGCTTATTGTCTACTTGCTGCGGCAGCTTACTGAAAAGCATGGAAATCTTTGGGTCCGCATCGCTGATGATGAT
GGGGAGTTCTTGCTTATCGAGGCTGCCAATGTGTTGCCGGACTGGTTGAGCCCCGAGACGGACGAGAACCGCGCC
TGGATTCACGACGGCAAGCTACTTCTGATCCCGCGCGACGCAGCTTGCCCGCGTGAAATAAAGTCTGGATCCATT
TCCTTGCCGCAGGCGCTTGACTTCATCCAGTCCCGCTCCGTGGAGTTGGTTCATTCCCCCTTTATCCAGGAAGAG
GCTTTTTACAGGCTGGGCAAATATCCGAGACACATCTCTGATTCTACTCACTGCTCACTTGTCACCATACCGAGG
AAGCTCGCTTTTGTCCTTCACTCGCTTCCCAAGTCCATCTCTCCGGCGGTGGAGTACTTCTATCTCAGAGACCCT
TTATCCCTAGAACCAATAATGTCTAGTTCAACAACTCTCCAATTCCCACCTCAGGATCTTGTCACCGTGAGCGTA
CGATTCAGCAGAGTTCTTTTCGCGCAGCTCAAATCGCAACAGTTGGACCCCCCCGCAGGATGGCAGAAAGTCATG
CGGGATGCGGTGCTCTCGGCGGCGCCAAATGACAAGGAGCAACTCGCGAGGACTGAGCTTGGAATGAAGCTGACA
GTCGGTTTTGAAGCACTTGCAGCAGCCCCAGGTCAGGACAAGAGAAAAGTCATCGAGGAAGTGGAAGCCTTGCTT
CAAGAGTTGTCAGAAAAGGACGGCAAGATGCTACCTACTGACGATGAGATTGGGCTGTGGCCGGAGTCCAATCGC
AACGACGACGAAACTTGGATGAATATTAACTATGATGATTTCGAGCGCGAGATATCTGGTCAACCTCGCAGGTCT
GACCGGGGGGGTTCAGGATTCGGTGATGCTCAAACTGAAACTGATTTGAGGAAAATTGTGTCACGTTTTGAAGCC
TTCTTGAACGACGAAAGTGCTGGTCTGGATGGCGCCGAGTTCGGAGATTCAAAGGACGAGGACGCCGACGACAAC
ACCGAAGAGTCCGAAGATGACGAAGATAGCGAGTTTGAAGACAAAGTGGTTGGCTTCGACGAGCAAGCCTTCTCT
TCCATGATGCGCACGATGTTGGGTTTACCGGAAACGGATACATCTGCTGCCCACGTCCATACGGGGGGGCAGACC
TCAGGGCAGTCTGGCCAAAGGGAGACAACAAGCCTCGAGGCCCAAGAAGTCGCTGAGATCCAAGAGCTATCGAAC
CAGATGGAAAACGAACTCCGGAACAGCGGCGCATTAAAACATGACGATGCAAGTGGCGATCAAATAGTCACAAAG
CAAGGGGGCAACGTCGGCGAGGAGCAAGACCTGAACCGTCAGGGTTCCGTGGTTCAAGATACCGAGGAAAACAGC
GACGTCCAGATCGATTATAATCTGGCACGAAATCTATTGGAAAGCTTTAAGGGCCAAGCAGGTTTGGCCGGGCCA
ACAGGAAACGTCCTGGGCATGATGGGAATTCGACTGCCCCGAGACGAGGATTGCCGAGACAACGAAGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail