Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4855
Gene name
LocationContig_459:10229..11068
Strand-
Gene length (bp)839
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04099 Sybindin Sybindin-like family 7.3E-24 3 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT70|BET5_SCHPO Transport protein particle subunit bet5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet5 PE=3 SV=2 1 143 3.0E-43
sp|Q2KMM2|TPPC1_RAT Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1 1 143 3.0E-31
sp|Q5NCF2|TPPC1_MOUSE Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1 1 143 3.0E-31
sp|Q9Y5R8|TPPC1_HUMAN Trafficking protein particle complex subunit 1 OS=Homo sapiens GN=TRAPPC1 PE=1 SV=1 1 143 3.0E-30
sp|Q17QI1|TPPC1_BOVIN Trafficking protein particle complex subunit 1 OS=Bos taurus GN=TRAPPC1 PE=2 SV=1 1 143 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT70|BET5_SCHPO Transport protein particle subunit bet5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet5 PE=3 SV=2 1 143 3.0E-43
sp|Q2KMM2|TPPC1_RAT Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1 1 143 3.0E-31
sp|Q5NCF2|TPPC1_MOUSE Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1 1 143 3.0E-31
sp|Q9Y5R8|TPPC1_HUMAN Trafficking protein particle complex subunit 1 OS=Homo sapiens GN=TRAPPC1 PE=1 SV=1 1 143 3.0E-30
sp|Q17QI1|TPPC1_BOVIN Trafficking protein particle complex subunit 1 OS=Bos taurus GN=TRAPPC1 PE=2 SV=1 1 143 3.0E-30
sp|Q03630|BET5_YEAST Trafficking protein particle complex subunit BET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET5 PE=1 SV=1 1 120 1.0E-22
sp|Q557G3|TPPC1_DICDI Trafficking protein particle complex subunit 1 OS=Dictyostelium discoideum GN=trappc1-1 PE=3 SV=1 3 143 6.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0030008 TRAPP complex Yes
GO:0051179 localization No
GO:0099023 vesicle tethering complex No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0140535 intracellular protein-containing complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4855
MTVYSFYIFDRHTECIYAKSWLPASSSTTRTKAAASDDAKLVFGTVFSLRNMVRKLGGDDDAFISYRTAQYKLHF
YETPANLRLVLLTDTASSSMRNVLHQIYINLWVEYVVKNPLAPVEHKGGDGVKNELFDLGLDQFIRGLIMSRPQL
GPKSESLAIITPLPSATAIMQLLVQGHGQLVLSEIGEEAFGGPGTASYTHPLCGRVVSAALRFSLPIIHS*
Coding >Ophun1|4855
ATGACCGTGTACTCATTCTACATCTTCGACCGTCACACCGAGTGTATCTACGCCAAGTCATGGCTCCCCGCCTCC
TCGTCGACAACGCGCACAAAAGCAGCAGCATCCGATGACGCAAAGCTCGTCTTCGGAACCGTCTTCTCCCTCCGC
AACATGGTGCGCAAGCTCGGGGGCGACGACGATGCCTTCATAAGCTACCGCACCGCCCAGTACAAGCTGCACTTT
TACGAGACGCCCGCCAACCTGCGCCTCGTGCTGCTGACGGACACGGCTTCTTCGAGTATGCGCAACGTGCTGCAT
CAGATCTACATCAATCTCTGGGTTGAGTACGTCGTCAAGAACCCGCTGGCCCCTGTCGAGCACAAAGGTGGCGAC
GGAGTCAAGAACGAGCTTTTCGACCTCGGTCTCGATCAGTTTATTCGTGGTCTTATCATGTCGCGTCCGCAACTG
GGGCCGAAGTCCGAGAGCCTCGCCATCATCACGCCGCTTCCTTCCGCCACTGCAATCATGCAGCTGCTCGTTCAG
GGTCATGGGCAGCTCGTCCTGAGCGAGATTGGGGAGGAAGCCTTTGGCGGACCCGGCACCGCAAGCTACACCCAC
CCTTTATGCGGTAGGGTCGTCTCAGCTGCTCTGCGCTTCTCGCTGCCAATCATACATTCATAG
Transcript >Ophun1|4855
ATGACCGTGTACTCATTCTACATCTTCGACCGTCACACCGAGTGTATCTACGCCAAGTCATGGCTCCCCGCCTCC
TCGTCGACAACGCGCACAAAAGCAGCAGCATCCGATGACGCAAAGCTCGTCTTCGGAACCGTCTTCTCCCTCCGC
AACATGGTGCGCAAGCTCGGGGGCGACGACGATGCCTTCATAAGCTACCGCACCGCCCAGTACAAGCTGCACTTT
TACGAGACGCCCGCCAACCTGCGCCTCGTGCTGCTGACGGACACGGCTTCTTCGAGTATGCGCAACGTGCTGCAT
CAGATCTACATCAATCTCTGGGTTGAGTACGTCGTCAAGAACCCGCTGGCCCCTGTCGAGCACAAAGGTGGCGAC
GGAGTCAAGAACGAGCTTTTCGACCTCGGTCTCGATCAGTTTATTCGTGGTCTTATCATGTCGCGTCCGCAACTG
GGGCCGAAGTCCGAGAGCCTCGCCATCATCACGCCGCTTCCTTCCGCCACTGCAATCATGCAGCTGCTCGTTCAG
GGTCATGGGCAGCTCGTCCTGAGCGAGATTGGGGAGGAAGCCTTTGGCGGACCCGGCACCGCAAGCTACACCCAC
CCTTTATGCGGTAGGGTCGTCTCAGCTGCTCTGCGCTTCTCGCTGCCAATCATACATTCATAG
Gene >Ophun1|4855
ATGACCGTGTACTCATTCTACATCTTCGACCGTCACAGTGCGTTCCCCTTCCCCTACCACTAATAAGAGGGAACA
CCACGACTAAAGCAGCGCCGCAAGCCGAGTGTATCTACGCCAAGTCATGGCTCCCCGCCTCCTCGTCGACAACGC
GCACAAAAGCAGCAGCATCCGATGACGCAAAGCTCGTCTTCGGAACCGTCTTCTCCCTCCGCAACATGGTGCGCA
AGCTCGGGGGCGACGACGATGCCTTCATAAGCTACCGCACCGCCCAGTACAAGCTGCACTTTTACGAGACGCCCG
CCAACCTGCGCCTCGTGCTGCTGACGGACACGGCTTCTTCGAGTATGCGCAACGTGCTGCATCAGATCTACATCA
ATCTCTGGGTTGAGTACGGTTCGTCGGTGTACATGTTGCAGGCTTCGGTGGGAGAGAGAGCTGACTGACGGCTTC
TAGTCGTCAAGAACCCGCTGGCCCCTGTCGAGCACAAAGGTGGCGACGGAGTCAAGAACGAGCTTTTCGACCTCG
GTCTCGATCAGTTTATTCGTGGTCTTATGTGACCCGCTGCCACCTGCCACATCTCCATCTCGGCCGTCAAGACTC
TCACCAGCATGTCGCGTCCGCAACTGGGGCCGAAGTCCGAGAGCCTCGCCATCATCACGCCGCTTCCTTCCGCCA
CTGCAATCATGCAGCTGCTCGTTCAGGGTCATGGGCAGCTCGTCCTGAGCGAGATTGGGGAGGAAGCCTTTGGCG
GACCCGGCACCGCAAGCTACACCCACCCTTTATGCGGTAGGGTCGTCTCAGCTGCTCTGCGCTTCTCGCTGCCAA
TCATACATTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail