Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4854
Gene name
LocationContig_459:8470..10116
Strand+
Gene length (bp)1646
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04882 Peroxin-3 Peroxin-3 3.9E-156 7 477

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q874C0|PEX3_YARLI Peroxisomal biogenesis factor 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX3 PE=3 SV=1 10 479 5.0E-58
sp|Q01497|PEX3_PICAN Peroxisomal biogenesis factor 3 OS=Pichia angusta GN=PEX3 PE=3 SV=1 1 477 4.0E-45
sp|Q92262|PEX3_PICPA Peroxisomal biogenesis factor 3 OS=Komagataella pastoris GN=PEX3 PE=1 SV=1 1 477 1.0E-38
sp|Q6BK00|PEX3_DEBHA Peroxisomal biogenesis factor 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX3 PE=3 SV=1 1 480 6.0E-35
sp|P28795|PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX3 PE=1 SV=1 5 477 6.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q874C0|PEX3_YARLI Peroxisomal biogenesis factor 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX3 PE=3 SV=1 10 479 5.0E-58
sp|Q01497|PEX3_PICAN Peroxisomal biogenesis factor 3 OS=Pichia angusta GN=PEX3 PE=3 SV=1 1 477 4.0E-45
sp|Q92262|PEX3_PICPA Peroxisomal biogenesis factor 3 OS=Komagataella pastoris GN=PEX3 PE=1 SV=1 1 477 1.0E-38
sp|Q6BK00|PEX3_DEBHA Peroxisomal biogenesis factor 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX3 PE=3 SV=1 1 480 6.0E-35
sp|P28795|PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX3 PE=1 SV=1 5 477 6.0E-23
sp|P56589|PEX3_HUMAN Peroxisomal biogenesis factor 3 OS=Homo sapiens GN=PEX3 PE=1 SV=1 1 475 3.0E-20
sp|Q60HE1|PEX3_MACFA Peroxisomal biogenesis factor 3 OS=Macaca fascicularis GN=PEX3 PE=2 SV=1 10 475 5.0E-20
sp|A6H7C2|PEX3_BOVIN Peroxisomal biogenesis factor 3 OS=Bos taurus GN=PEX3 PE=2 SV=1 1 475 1.0E-19
sp|O94227|PEX3_KLULA Peroxisomal biogenesis factor 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX3 PE=3 SV=1 43 477 3.0E-18
sp|Q9JJK3|PEX3_CRILO Peroxisomal biogenesis factor 3 OS=Cricetulus longicaudatus GN=PEX3 PE=2 SV=1 10 475 6.0E-18
sp|Q759H4|PEX3_ASHGO Peroxisomal biogenesis factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX3 PE=3 SV=1 41 477 1.0E-17
sp|Q9JJK4|PEX3_RAT Peroxisomal biogenesis factor 3 OS=Rattus norvegicus GN=Pex3 PE=1 SV=1 10 475 1.0E-17
sp|Q9QXY9|PEX3_MOUSE Peroxisomal biogenesis factor 3 OS=Mus musculus GN=Pex3 PE=1 SV=1 10 475 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005779 integral component of peroxisomal membrane Yes
GO:0007031 peroxisome organization Yes
GO:0016021 integral component of membrane No
GO:0016043 cellular component organization No
GO:0006996 organelle organization No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0031300 intrinsic component of organelle membrane No
GO:0005575 cellular_component No
GO:0031231 intrinsic component of peroxisomal membrane No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0031301 integral component of organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4854
MFSAARRWLRNNRTPLAVGIGVVGAGYLAAQYIVAKINDARERMSSERIAKDNLRRRFEQNQEDCTFTVLALLPT
ATANVLSVLNTEQITYEIQQMKTSARGAKSDSATPPSIADTTLTEDDGKSMASLQSESGIHVSQIATSASSPSPF
AVSAESSASDGRASKMRKTKRQLWDDLAISGLSLLNPSPTAYGSRADDFVPSIAATRAFTLVYTLALLVMLTRIQ
LNLLGRRSYLSSVVSLAAGAQHTPISLENKDDDKTDEYGCDFDTNRKYLTFSWWLLNRGWVELMHRVESAVRTVF
GGLSPRDLVTFQRYCELTMDVRKLVEGATPEERRNSDWLRFVLPRPELEAEVIRESGILDDNASQGGNSQPSSPA
LRRLLDETADLVESPAFCHVLTLVLDSAFSLLVDNKLAAEAYETAEDQARDQLRSKAVLLPKILSVLTRQAHVIG
NGMPNEYLQEMETVRELEAFAAVVYSSNWENEMRDEDVEDVAAKLRSAIRGQSGDGEESLVMVEPESSFESAWER
AMDKR*
Coding >Ophun1|4854
ATGTTCTCCGCGGCTCGCCGCTGGTTGCGCAACAACCGGACGCCGCTTGCCGTCGGCATCGGAGTCGTTGGCGCC
GGTTATCTCGCGGCGCAATATATCGTTGCCAAGATCAACGACGCTCGCGAGCGTATGAGCAGCGAGCGCATCGCC
AAGGACAATCTGCGACGCCGCTTTGAGCAGAACCAGGAGGACTGCACCTTTACCGTTCTGGCTCTTCTCCCCACC
GCCACCGCCAATGTCCTGTCGGTCCTCAATACGGAGCAAATCACGTACGAGATTCAGCAGATGAAGACTTCGGCT
AGAGGCGCAAAGTCCGACTCGGCTACTCCCCCGAGCATTGCCGATACCACATTGACTGAAGACGACGGCAAGAGC
ATGGCCAGCTTGCAAAGCGAGAGCGGCATCCATGTGAGCCAGATTGCCACGTCTGCGTCCTCACCCTCGCCCTTT
GCTGTGTCTGCCGAATCGTCAGCCTCCGATGGCCGTGCCTCCAAGATGCGCAAGACAAAGAGACAGCTCTGGGAT
GACCTGGCCATCAGTGGTTTGTCGCTTCTGAACCCCTCTCCCACCGCCTATGGCAGCCGAGCTGATGATTTTGTA
CCGTCGATAGCCGCCACCAGAGCATTCACCCTCGTATACACGCTCGCCCTCCTCGTCATGTTGACACGCATCCAG
CTCAACCTCCTAGGCCGGCGGAGCTACCTCTCCAGCGTCGTGTCGCTCGCCGCCGGCGCCCAGCACACCCCCATC
AGCCTCGAAAATAAAGACGACGACAAGACGGACGAATACGGCTGTGATTTCGACACCAATCGCAAGTACCTGACA
TTTAGCTGGTGGCTCCTCAACAGAGGATGGGTCGAGTTGATGCACCGCGTCGAAAGCGCCGTCCGCACCGTCTTC
GGCGGCCTGAGCCCGCGTGACCTGGTCACCTTTCAGAGGTACTGCGAGCTGACAATGGACGTCCGAAAGCTGGTC
GAGGGCGCCACCCCCGAGGAGCGCCGGAATTCGGACTGGCTCAGATTCGTGCTGCCCAGGCCGGAGCTCGAGGCC
GAGGTGATTCGCGAGTCGGGCATTCTCGACGACAACGCCTCACAGGGCGGCAACTCTCAGCCGTCATCACCGGCT
CTTCGCAGGCTTCTGGACGAGACTGCCGACCTCGTCGAGTCGCCGGCCTTTTGTCACGTCCTCACGCTGGTACTC
GATTCCGCCTTTTCCCTACTCGTCGACAACAAGCTCGCGGCCGAAGCGTATGAGACGGCGGAAGATCAGGCGCGG
GACCAGCTGCGTTCCAAAGCAGTCTTGCTGCCAAAGATCCTCTCCGTCCTGACACGCCAAGCCCACGTCATCGGA
AATGGCATGCCCAACGAATACCTTCAGGAGATGGAGACGGTGCGCGAACTCGAGGCCTTTGCCGCCGTAGTGTAC
TCGAGCAATTGGGAGAACGAGATGCGGGACGAGGATGTCGAAGACGTCGCGGCCAAGTTGCGATCGGCAATCCGT
GGACAGAGCGGCGATGGCGAGGAAAGCCTCGTCATGGTGGAACCCGAAAGCAGCTTCGAGAGCGCGTGGGAGAGG
GCCATGGATAAGAGGTGA
Transcript >Ophun1|4854
ATGTTCTCCGCGGCTCGCCGCTGGTTGCGCAACAACCGGACGCCGCTTGCCGTCGGCATCGGAGTCGTTGGCGCC
GGTTATCTCGCGGCGCAATATATCGTTGCCAAGATCAACGACGCTCGCGAGCGTATGAGCAGCGAGCGCATCGCC
AAGGACAATCTGCGACGCCGCTTTGAGCAGAACCAGGAGGACTGCACCTTTACCGTTCTGGCTCTTCTCCCCACC
GCCACCGCCAATGTCCTGTCGGTCCTCAATACGGAGCAAATCACGTACGAGATTCAGCAGATGAAGACTTCGGCT
AGAGGCGCAAAGTCCGACTCGGCTACTCCCCCGAGCATTGCCGATACCACATTGACTGAAGACGACGGCAAGAGC
ATGGCCAGCTTGCAAAGCGAGAGCGGCATCCATGTGAGCCAGATTGCCACGTCTGCGTCCTCACCCTCGCCCTTT
GCTGTGTCTGCCGAATCGTCAGCCTCCGATGGCCGTGCCTCCAAGATGCGCAAGACAAAGAGACAGCTCTGGGAT
GACCTGGCCATCAGTGGTTTGTCGCTTCTGAACCCCTCTCCCACCGCCTATGGCAGCCGAGCTGATGATTTTGTA
CCGTCGATAGCCGCCACCAGAGCATTCACCCTCGTATACACGCTCGCCCTCCTCGTCATGTTGACACGCATCCAG
CTCAACCTCCTAGGCCGGCGGAGCTACCTCTCCAGCGTCGTGTCGCTCGCCGCCGGCGCCCAGCACACCCCCATC
AGCCTCGAAAATAAAGACGACGACAAGACGGACGAATACGGCTGTGATTTCGACACCAATCGCAAGTACCTGACA
TTTAGCTGGTGGCTCCTCAACAGAGGATGGGTCGAGTTGATGCACCGCGTCGAAAGCGCCGTCCGCACCGTCTTC
GGCGGCCTGAGCCCGCGTGACCTGGTCACCTTTCAGAGGTACTGCGAGCTGACAATGGACGTCCGAAAGCTGGTC
GAGGGCGCCACCCCCGAGGAGCGCCGGAATTCGGACTGGCTCAGATTCGTGCTGCCCAGGCCGGAGCTCGAGGCC
GAGGTGATTCGCGAGTCGGGCATTCTCGACGACAACGCCTCACAGGGCGGCAACTCTCAGCCGTCATCACCGGCT
CTTCGCAGGCTTCTGGACGAGACTGCCGACCTCGTCGAGTCGCCGGCCTTTTGTCACGTCCTCACGCTGGTACTC
GATTCCGCCTTTTCCCTACTCGTCGACAACAAGCTCGCGGCCGAAGCGTATGAGACGGCGGAAGATCAGGCGCGG
GACCAGCTGCGTTCCAAAGCAGTCTTGCTGCCAAAGATCCTCTCCGTCCTGACACGCCAAGCCCACGTCATCGGA
AATGGCATGCCCAACGAATACCTTCAGGAGATGGAGACGGTGCGCGAACTCGAGGCCTTTGCCGCCGTAGTGTAC
TCGAGCAATTGGGAGAACGAGATGCGGGACGAGGATGTCGAAGACGTCGCGGCCAAGTTGCGATCGGCAATCCGT
GGACAGAGCGGCGATGGCGAGGAAAGCCTCGTCATGGTGGAACCCGAAAGCAGCTTCGAGAGCGCGTGGGAGAGG
GCCATGGATAAGAGGTGA
Gene >Ophun1|4854
ATGTTCTCCGCGGCTCGCCGCTGGTTGCGCAACAACCGGACGCCGCTTGCCGTCGGCATCGGAGTCGTTGGCGCC
GGTTATCTCGCGGCGCAATATATCGTTGCCAAGATCAACGACGCTCGCGAGCGTATGAGCAGCGAGCGCATCGCC
AAGGACAAGTTGGTCGGGTCCAATGAAAGCTATATGTCGTCCCTTCTGACCGTTATGAAAGTCTGCGACGCCGCT
TTGAGCAGAACCAGGAGGACTGCACCTTTACCGTTCTGGCTCTTCTCCCCACCGCCACCGCCAATGTCCTGTCGG
TCCTCAATACGGAGCAAATCACGTACGAGATTCAGCAGATGAAGACTTCGGCTAGAGGCGCAAAGTCCGACTCGG
CTACTCCCCCGAGCATTGCCGATACCACATTGACTGAAGACGACGGCAAGAGCATGGCCAGCTTGCAAAGCGAGA
GCGGCATCCATGTGAGCCAGATTGCCACGTCTGCGTCCTCACCCTCGCCCTTTGCTGTGTCTGCCGAATCGTCAG
CCTCCGATGGCCGTGCCTCCAAGATGCGCAAGACAAAGAGACAGCTCTGGGATGACCTGGCCATCAGTGGTTTGT
CGCTTCTGAACCCCTCTCCCACCGCCTATGGCAGCCGAGCTGATGATTTTGTACCGTCGATAGCCGCCACCAGAG
CATTCACCCTCGTATACACGCTCGCCCTCCTCGTCATGTTGACACGCATCCAGCTCAACCTCCTAGGCCGGCGGA
GCTACCTCTCCAGCGTCGTGTCGCTCGCCGCCGGCGCCCAGCACACCCCCATCAGCCTCGAAAATAAAGACGACG
ACAAGACGGACGAATACGGCTGTGATTTCGACACCAATCGCAAGTACCTGACATTTAGCTGGTGGCTCCTCAACA
GAGGATGGGTCGAGTTGATGCACCGCGTCGAAAGCGCCGTCCGCACCGTCTTCGGCGGCCTGAGCCCGCGTGACC
TGGTCACCTTTCAGAGGTACTGCGAGCTGACAATGGACGTCCGAAAGCTGGTCGAGGGCGCCACCCCCGAGGAGC
GCCGGAATTCGGACTGGCTCAGATTCGTGCTGCCCAGGCCGGAGCTCGAGGCCGAGGTGATTCGCGAGTCGGGCA
TTCTCGACGACAACGCCTCACAGGGCGGCAACTCTCAGCCGTCATCACCGGCTCTTCGCAGGCTTCTGGACGAGA
CTGCCGACCTCGTCGAGTCGCCGGCCTTTTGTCACGTCCTCACGCTGGTACTCGATTCCGCCTTTTCCCTACTCG
TCGACAACAAGCTCGCGGCCGAAGCGTATGAGACGGCGGAAGATCAGGCGCGGGACCAGCTGCGTTCCAAAGCAG
TCTTGCTGCCAAAGATCCTCTCCGTCCTGACACGCCAAGCCCACGTCATCGGAAATGGCATGCCCAACGAATACC
TTCAGGAGATGGAGACGGTGCGCGAACTCGAGGCCTTTGCCGCCGTAGTGTACTCGAGCAATTGGGAGAACGAGA
TGCGGGACGAGGATGTCGAAGACGTCGCGGCCAAGTTGCGATCGGCAATCCGTGGACAGAGCGGCGATGGCGAGG
AAAGCCTCGTCATGGTGGAACCCGAAAGCAGCTTCGAGAGCGCGTGGGAGAGGGCCATGGATAAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail