Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4846
Gene name
LocationContig_458:4563..6091
Strand+
Gene length (bp)1528
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00346 Complex1_49kDa Respiratory-chain NADH dehydrogenase, 49 Kd subunit 5.1E-122 203 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22142|NDUS2_NEUCR NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-49 PE=1 SV=2 2 473 0.0E+00
sp|Q641Y2|NDUS2_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus GN=Ndufs2 PE=1 SV=1 82 473 0.0E+00
sp|Q91WD5|NDUS2_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus GN=Ndufs2 PE=1 SV=1 82 473 0.0E+00
sp|P17694|NDUS2_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus GN=NDUFS2 PE=1 SV=2 1 473 0.0E+00
sp|O21270|NDUS2_RECAM NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Reclinomonas americana GN=NAD7 PE=3 SV=1 84 473 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22142|NDUS2_NEUCR NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-49 PE=1 SV=2 2 473 0.0E+00
sp|Q641Y2|NDUS2_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus GN=Ndufs2 PE=1 SV=1 82 473 0.0E+00
sp|Q91WD5|NDUS2_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus GN=Ndufs2 PE=1 SV=1 82 473 0.0E+00
sp|P17694|NDUS2_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus GN=NDUFS2 PE=1 SV=2 1 473 0.0E+00
sp|O21270|NDUS2_RECAM NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Reclinomonas americana GN=NAD7 PE=3 SV=1 84 473 0.0E+00
sp|Q0MQG5|NDUS2_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Pan troglodytes GN=NDUFS2 PE=2 SV=1 1 473 0.0E+00
sp|O75306|NDUS2_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens GN=NDUFS2 PE=1 SV=2 1 473 0.0E+00
sp|Q0MQG4|NDUS2_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS2 PE=2 SV=1 1 473 0.0E+00
sp|Q0MQG3|NDUS2_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFS2 PE=2 SV=1 1 473 0.0E+00
sp|Q9TC96|NDUS2_NEPOL NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nephroselmis olivacea GN=NAD7 PE=3 SV=1 85 473 0.0E+00
sp|Q37619|NDUS2_PROWI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Prototheca wickerhamii GN=NAD7 PE=3 SV=1 86 473 0.0E+00
sp|Q93873|NDUS2_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Caenorhabditis elegans GN=gas-1 PE=3 SV=2 70 473 0.0E+00
sp|P93306|NDUS2_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Arabidopsis thaliana GN=NAD7 PE=2 SV=2 81 473 0.0E+00
sp|Q37720|NDUS2_PYLLI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Pylaiella littoralis GN=NAD7 PE=3 SV=1 89 473 0.0E+00
sp|Q37384|NDUS2_ACACA NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Acanthamoeba castellanii GN=NAD7 PE=3 SV=1 82 473 0.0E+00
sp|Q5GTF8|NUOD_WOLTR NADH-quinone oxidoreductase subunit D OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=nuoD PE=3 SV=1 92 473 0.0E+00
sp|B3CLH1|NUOD_WOLPP NADH-quinone oxidoreductase subunit D OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|A9HRT9|NUOD_GLUDA NADH-quinone oxidoreductase subunit D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoD PE=3 SV=2 76 473 0.0E+00
sp|B6ISX8|NUOD_RHOCS NADH-quinone oxidoreductase subunit D OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=nuoD PE=3 SV=1 81 473 0.0E+00
sp|Q9TAJ7|NDUS2_CAFRO NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Cafeteria roenbergensis GN=NAD7 PE=3 SV=1 81 473 0.0E+00
sp|Q3YS37|NUOD_EHRCJ NADH-quinone oxidoreductase subunit D OS=Ehrlichia canis (strain Jake) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q73HJ8|NUOD_WOLPM NADH-quinone oxidoreductase subunit D OS=Wolbachia pipientis wMel GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q5HB88|NUOD_EHRRW NADH-quinone oxidoreductase subunit D OS=Ehrlichia ruminantium (strain Welgevonden) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q2GGK7|NUOD_EHRCR NADH-quinone oxidoreductase subunit D OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q5FGV3|NUOD_EHRRG NADH-quinone oxidoreductase subunit D OS=Ehrlichia ruminantium (strain Gardel) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A7HY46|NUOD_PARL1 NADH-quinone oxidoreductase subunit D OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nuoD PE=3 SV=1 85 473 0.0E+00
sp|Q4FM88|NUOD_PELUB NADH-quinone oxidoreductase subunit D OS=Pelagibacter ubique (strain HTCC1062) GN=nuoD PE=3 SV=1 84 473 0.0E+00
sp|B3CSH1|NUOD_ORITI NADH-quinone oxidoreductase subunit D OS=Orientia tsutsugamushi (strain Ikeda) GN=nuoD PE=3 SV=1 84 473 0.0E+00
sp|Q0BSK5|NUOD_GRABC NADH-quinone oxidoreductase subunit D OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A5CES2|NUOD_ORITB NADH-quinone oxidoreductase subunit D OS=Orientia tsutsugamushi (strain Boryong) GN=nuoD PE=3 SV=1 84 473 0.0E+00
sp|Q5PAR3|NUOD_ANAMM NADH-quinone oxidoreductase subunit D OS=Anaplasma marginale (strain St. Maries) GN=nuoD PE=3 SV=1 84 473 0.0E+00
sp|Q4UM08|NUOD_RICFE NADH-quinone oxidoreductase subunit D OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoD PE=3 SV=1 84 473 0.0E+00
sp|Q2W3I7|NUOD_MAGSA NADH-quinone oxidoreductase subunit D OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B4RPI1|NUOD_NEIG2 NADH-quinone oxidoreductase subunit D OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q5F618|NUOD_NEIG1 NADH-quinone oxidoreductase subunit D OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q11JK3|NUOD_CHESB NADH-quinone oxidoreductase subunit D OS=Chelativorans sp. (strain BNC1) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q9K1C0|NUOD_NEIMB NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup B (strain MC58) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q2RU37|NUOD_RHORT NADH-quinone oxidoreductase subunit D OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A1INN7|NUOD_NEIMA NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q1RJI9|NUOD_RICBR NADH-quinone oxidoreductase subunit D OS=Rickettsia bellii (strain RML369-C) GN=nuoD PE=3 SV=2 84 473 0.0E+00
sp|A8GX80|NUOD_RICB8 NADH-quinone oxidoreductase subunit D OS=Rickettsia bellii (strain OSU 85-389) GN=nuoD PE=3 SV=1 84 473 0.0E+00
sp|A1KRS5|NUOD_NEIMF NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A9M3D9|NUOD_NEIM0 NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup C (strain 053442) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A8GN50|NUOD_RICAH NADH-quinone oxidoreductase subunit D OS=Rickettsia akari (strain Hartford) GN=nuoD PE=3 SV=2 84 473 0.0E+00
sp|Q92ID8|NUOD_RICCN NADH-quinone oxidoreductase subunit D OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoD PE=3 SV=2 84 473 0.0E+00
sp|Q2YA24|NUOD_NITMU NADH-quinone oxidoreductase subunit D OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q215I0|NUOD_RHOPB NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q89KI9|NUOD_BRADU NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B0BX71|NUOD_RICRO NADH-quinone oxidoreductase subunit D OS=Rickettsia rickettsii (strain Iowa) GN=nuoD PE=3 SV=2 91 473 0.0E+00
sp|A8EZ86|NUOD_RICCK NADH-quinone oxidoreductase subunit D OS=Rickettsia canadensis (strain McKiel) GN=nuoD PE=3 SV=2 84 473 0.0E+00
sp|A5FX11|NUOD_ACICJ NADH-quinone oxidoreductase subunit D OS=Acidiphilium cryptum (strain JF-5) GN=nuoD PE=3 SV=1 90 473 0.0E+00
sp|Q36450|NDUS2_NICSY NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nicotiana sylvestris GN=NAD7 PE=2 SV=1 81 473 0.0E+00
sp|A8GRR5|NUOD_RICRS NADH-quinone oxidoreductase subunit D OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoD PE=3 SV=1 91 473 0.0E+00
sp|B0ULK7|NUOD_METS4 NADH-quinone oxidoreductase subunit D OS=Methylobacterium sp. (strain 4-46) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q9ZDH4|NUOD_RICPR NADH-quinone oxidoreductase subunit D OS=Rickettsia prowazekii (strain Madrid E) GN=nuoD PE=3 SV=1 91 473 0.0E+00
sp|A8F1C5|NUOD_RICM5 NADH-quinone oxidoreductase subunit D OS=Rickettsia massiliae (strain Mtu5) GN=nuoD PE=3 SV=2 84 473 0.0E+00
sp|Q6N5M5|NUOD_RHOPA NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|B3Q7N3|NUOD_RHOPT NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q2IWY2|NUOD_RHOP2 NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoD PE=3 SV=1 79 473 0.0E+00
sp|Q3SJQ4|NUOD_THIDA NADH-quinone oxidoreductase subunit D OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q68X19|NUOD_RICTY NADH-quinone oxidoreductase subunit D OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoD PE=3 SV=2 91 473 0.0E+00
sp|Q98KQ8|NUOD_RHILO NADH-quinone oxidoreductase subunit D OS=Rhizobium loti (strain MAFF303099) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q8YGK3|NUOD_BRUME NADH-quinone oxidoreductase subunit D OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B0SZ49|NUOD_CAUSK NADH-quinone oxidoreductase subunit D OS=Caulobacter sp. (strain K31) GN=nuoD PE=3 SV=1 81 473 0.0E+00
sp|A4WU31|NUOD_RHOS5 NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoD PE=3 SV=1 85 473 0.0E+00
sp|B6JGW3|NUOD_OLICO NADH-quinone oxidoreductase subunit D OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|B0CLD2|NUOD_BRUSI NADH-quinone oxidoreductase subunit D OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A5VPY6|NUOD_BRUO2 NADH-quinone oxidoreductase subunit D OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A9MAI2|NUOD_BRUC2 NADH-quinone oxidoreductase subunit D OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q1QL87|NUOD2_NITHX NADH-quinone oxidoreductase subunit D 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoD2 PE=3 SV=1 81 473 0.0E+00
sp|A5EK97|NUOD_BRASB NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|A9CJA9|NUOD_AGRFC NADH-quinone oxidoreductase subunit D OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A3PIX1|NUOD_RHOS1 NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoD PE=3 SV=1 85 473 0.0E+00
sp|B4RCM6|NUOD_PHEZH NADH-quinone oxidoreductase subunit D OS=Phenylobacterium zucineum (strain HLK1) GN=nuoD PE=3 SV=1 71 473 0.0E+00
sp|Q8G1B4|NUOD_BRUSU NADH-quinone oxidoreductase subunit D OS=Brucella suis biovar 1 (strain 1330) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q3J3F8|NUOD_RHOS4 NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoD PE=3 SV=1 85 473 0.0E+00
sp|Q2GJY9|NUOD_ANAPZ NADH-quinone oxidoreductase subunit D OS=Anaplasma phagocytophilum (strain HZ) GN=nuoD PE=3 SV=1 91 473 0.0E+00
sp|B2T2F0|NUOD_BURPP NADH-quinone oxidoreductase subunit D OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q07NM3|NUOD_RHOP5 NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|A6X1N0|NUOD_OCHA4 NADH-quinone oxidoreductase subunit D OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q0APY7|NUOD_MARMM NADH-quinone oxidoreductase subunit D OS=Maricaulis maris (strain MCS10) GN=nuoD PE=3 SV=1 88 473 0.0E+00
sp|Q2KV09|NUOD_BORA1 NADH-quinone oxidoreductase subunit D OS=Bordetella avium (strain 197N) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B1LUN4|NUOD_METRJ NADH-quinone oxidoreductase subunit D OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B4E5L9|NUOD_BURCJ NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A0K920|NUOD_BURCH NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain HI2424) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q1BV16|NUOD_BURCA NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain AU 1054) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q142H0|NUOD_BURXL NADH-quinone oxidoreductase subunit D OS=Burkholderia xenovorans (strain LB400) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q135X7|NUOD_RHOPS NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q5LPR7|NUOD_RUEPO NADH-quinone oxidoreductase subunit D OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nuoD PE=3 SV=1 85 473 0.0E+00
sp|Q9A6X4|NUOD_CAUCR NADH-quinone oxidoreductase subunit D OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q3SRE6|NUOD_NITWN NADH-quinone oxidoreductase subunit D OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|B5ZYL5|NUOD_RHILW NADH-quinone oxidoreductase subunit D OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q39EE8|NUOD_BURL3 NADH-quinone oxidoreductase subunit D OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A9AFZ0|NUOD_BURM1 NADH-quinone oxidoreductase subunit D OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q1QP34|NUOD1_NITHX NADH-quinone oxidoreductase subunit D 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoD1 PE=3 SV=1 88 473 0.0E+00
sp|A1W4M5|NUOD_ACISJ NADH-quinone oxidoreductase subunit D OS=Acidovorax sp. (strain JS42) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q57DU8|NUOD_BRUAB NADH-quinone oxidoreductase subunit D OS=Brucella abortus biovar 1 (strain 9-941) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q2YNG0|NUOD_BRUA2 NADH-quinone oxidoreductase subunit D OS=Brucella abortus (strain 2308) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B2S546|NUOD_BRUA1 NADH-quinone oxidoreductase subunit D OS=Brucella abortus (strain S19) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A9IUP7|NUOD_BART1 NADH-quinone oxidoreductase subunit D OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B1ZA43|NUOD_METPB NADH-quinone oxidoreductase subunit D OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A9W1N0|NUOD_METEP NADH-quinone oxidoreductase subunit D OS=Methylobacterium extorquens (strain PA1) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q7VZQ2|NUOD_BORPE NADH-quinone oxidoreductase subunit D OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q0BDD3|NUOD_BURCM NADH-quinone oxidoreductase subunit D OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A4YVK9|NUOD_BRASO NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium sp. (strain ORS278) GN=nuoD PE=3 SV=1 87 473 0.0E+00
sp|Q63VN0|NUOD_BURPS NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain K96243) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A3N7M0|NUOD_BURP6 NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 668) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q3JUA6|NUOD_BURP1 NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 1710b) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A3NTA9|NUOD_BURP0 NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 1106a) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A1V2L9|NUOD_BURMS NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain SAVP1) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q62IN8|NUOD_BURMA NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain ATCC 23344) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A2S456|NUOD_BURM9 NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain NCTC 10229) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A3MIA4|NUOD_BURM7 NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain NCTC 10247) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B1YTQ4|NUOD_BURA4 NADH-quinone oxidoreductase subunit D OS=Burkholderia ambifaria (strain MC40-6) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|B1JVN8|NUOD_BURCC NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain MC0-3) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q7W5B0|NUOD_BORPA NADH-quinone oxidoreductase subunit D OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q7WCU2|NUOD_BORBR NADH-quinone oxidoreductase subunit D OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q2SZN2|NUOD_BURTA NADH-quinone oxidoreductase subunit D OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q1GZL2|NUOD_METFK NADH-quinone oxidoreductase subunit D OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|Q7NZH8|NUOD_CHRVO NADH-quinone oxidoreductase subunit D OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|P56907|NUOD1_RHIME NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium meliloti (strain 1021) GN=nuoD1 PE=3 SV=1 86 473 0.0E+00
sp|B3PW00|NUOD1_RHIE6 NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium etli (strain CIAT 652) GN=nuoD1 PE=3 SV=1 86 473 0.0E+00
sp|Q163Q5|NUOD_ROSDO NADH-quinone oxidoreductase subunit D OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=nuoD PE=3 SV=1 85 473 0.0E+00
sp|B2JDM5|NUOD_BURP8 NADH-quinone oxidoreductase subunit D OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=nuoD PE=3 SV=1 86 473 0.0E+00
sp|A9II07|NUOD_BORPD NADH-quinone oxidoreductase subunit D OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=nuoD PE=3 SV=1 86 473 1.0E-180
sp|A4JGC7|NUOD_BURVG NADH-quinone oxidoreductase subunit D OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nuoD PE=3 SV=1 86 473 1.0E-180
sp|Q2K9T1|NUOD1_RHIEC NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoD1 PE=3 SV=1 86 473 2.0E-180
sp|A1USX0|NUOD_BARBK NADH-quinone oxidoreductase subunit D OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=nuoD PE=3 SV=1 86 473 3.0E-180
sp|Q6FZY8|NUOD_BARQU NADH-quinone oxidoreductase subunit D OS=Bartonella quintana (strain Toulouse) GN=nuoD PE=3 SV=1 86 473 4.0E-180
sp|A8I3Z3|NUOD_AZOC5 NADH-quinone oxidoreductase subunit D OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nuoD PE=3 SV=1 87 473 6.0E-180
sp|A6U7W6|NUOD1_SINMW NADH-quinone oxidoreductase subunit D 1 OS=Sinorhizobium medicae (strain WSM419) GN=nuoD1 PE=3 SV=1 86 473 6.0E-180
sp|Q1MIL2|NUOD_RHIL3 NADH-quinone oxidoreductase subunit D OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nuoD PE=3 SV=1 86 473 6.0E-180
sp|B2ILG7|NUOD2_BEII9 NADH-quinone oxidoreductase subunit D 2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoD2 PE=3 SV=1 88 473 8.0E-180
sp|A6SY08|NUOD_JANMA NADH-quinone oxidoreductase subunit D OS=Janthinobacterium sp. (strain Marseille) GN=nuoD PE=3 SV=1 86 473 9.0E-180
sp|B2U7Q8|NUOD_RALPJ NADH-quinone oxidoreductase subunit D OS=Ralstonia pickettii (strain 12J) GN=nuoD PE=3 SV=1 87 473 9.0E-180
sp|Q5P1E7|NUOD_AROAE NADH-quinone oxidoreductase subunit D OS=Aromatoleum aromaticum (strain EbN1) GN=nuoD PE=3 SV=1 86 473 1.0E-179
sp|A1K5B1|NUOD_AZOSB NADH-quinone oxidoreductase subunit D OS=Azoarcus sp. (strain BH72) GN=nuoD PE=3 SV=1 86 473 1.0E-179
sp|Q2G5Y6|NUOD_NOVAD NADH-quinone oxidoreductase subunit D OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=nuoD PE=3 SV=1 87 473 2.0E-179
sp|Q2GDJ8|NUOD_NEOSM NADH-quinone oxidoreductase subunit D OS=Neorickettsia sennetsu (strain Miyayama) GN=nuoD PE=3 SV=1 92 473 3.0E-179
sp|A7IPA4|NUOD_XANP2 NADH-quinone oxidoreductase subunit D OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=nuoD PE=3 SV=1 86 473 3.0E-179
sp|Q6G391|NUOD_BARHE NADH-quinone oxidoreductase subunit D OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=nuoD PE=3 SV=1 86 473 4.0E-179
sp|Q0A778|NUOD_ALKEH NADH-quinone oxidoreductase subunit D OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nuoD PE=3 SV=1 85 473 6.0E-179
sp|Q0AHJ7|NUOD_NITEC NADH-quinone oxidoreductase subunit D OS=Nitrosomonas eutropha (strain C91) GN=nuoD PE=3 SV=1 87 473 9.0E-179
sp|A2SFM9|NUOD_METPP NADH-quinone oxidoreductase subunit D OS=Methylibium petroleiphilum (strain PM1) GN=nuoD PE=3 SV=1 86 473 1.0E-178
sp|Q82TU6|NUOD_NITEU NADH-quinone oxidoreductase subunit D OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nuoD PE=3 SV=1 86 473 7.0E-178
sp|Q1GIN9|NUOD_RUEST NADH-quinone oxidoreductase subunit D OS=Ruegeria sp. (strain TM1040) GN=nuoD PE=3 SV=1 69 473 1.0E-177
sp|A4G641|NUOD_HERAR NADH-quinone oxidoreductase subunit D OS=Herminiimonas arsenicoxydans GN=nuoD PE=3 SV=1 86 473 2.0E-177
sp|A1TLL9|NUOD_ACIAC NADH-quinone oxidoreductase subunit D OS=Acidovorax citrulli (strain AAC00-1) GN=nuoD PE=3 SV=1 86 473 4.0E-177
sp|A5VAM0|NUOD_SPHWW NADH-quinone oxidoreductase subunit D OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=nuoD PE=3 SV=1 72 473 7.0E-177
sp|Q31HF7|NUOD_THICR NADH-quinone oxidoreductase subunit D OS=Thiomicrospira crunogena (strain XCL-2) GN=nuoD PE=3 SV=1 86 473 9.0E-177
sp|A1B495|NUOD_PARDP NADH-quinone oxidoreductase subunit D OS=Paracoccus denitrificans (strain Pd 1222) GN=nuoD PE=1 SV=1 64 473 1.0E-176
sp|B1Y830|NUOD_LEPCP NADH-quinone oxidoreductase subunit D OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=nuoD PE=3 SV=1 86 473 1.0E-176
sp|B3R3X0|NUOD_CUPTR NADH-quinone oxidoreductase subunit D OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=nuoD PE=3 SV=1 87 473 2.0E-176
sp|Q3J831|NUOD_NITOC NADH-quinone oxidoreductase subunit D OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoD PE=3 SV=1 86 473 7.0E-176
sp|P29916|NQO4_PARDE NADH-quinone oxidoreductase subunit 4 OS=Paracoccus denitrificans GN=nqo4 PE=1 SV=1 64 473 7.0E-176
sp|Q127X5|NUOD_POLSJ NADH-quinone oxidoreductase subunit D OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nuoD PE=3 SV=1 86 473 7.0E-176
sp|Q1LPW0|NUOD_CUPMC NADH-quinone oxidoreductase subunit D OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nuoD PE=3 SV=1 87 473 2.0E-175
sp|A8LIT9|NUOD_DINSH NADH-quinone oxidoreductase subunit D OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=nuoD PE=3 SV=1 85 473 3.0E-175
sp|Q1GTK0|NUOD_SPHAL NADH-quinone oxidoreductase subunit D OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=nuoD PE=3 SV=2 84 473 3.0E-175
sp|A1VM63|NUOD_POLNA NADH-quinone oxidoreductase subunit D OS=Polaromonas naphthalenivorans (strain CJ2) GN=nuoD PE=3 SV=1 86 473 4.0E-175
sp|Q0C1E4|NUOD_HYPNA NADH-quinone oxidoreductase subunit D OS=Hyphomonas neptunium (strain ATCC 15444) GN=nuoD PE=3 SV=1 88 473 4.0E-175
sp|Q21YC4|NUOD_RHOFT NADH-quinone oxidoreductase subunit D OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nuoD PE=3 SV=1 86 473 4.0E-175
sp|A1WLP1|NUOD_VEREI NADH-quinone oxidoreductase subunit D OS=Verminephrobacter eiseniae (strain EF01-2) GN=nuoD PE=3 SV=1 86 473 6.0E-175
sp|Q28T72|NUOD_JANSC NADH-quinone oxidoreductase subunit D OS=Jannaschia sp. (strain CCS1) GN=nuoD PE=3 SV=1 85 473 1.0E-174
sp|Q9PGJ2|NUOD_XYLFA NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain 9a5c) GN=nuoD PE=3 SV=1 64 473 1.0E-174
sp|A0LDS4|NUOD_MAGMM NADH-quinone oxidoreductase subunit D OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nuoD PE=3 SV=1 82 473 1.0E-174
sp|B4SJH6|NUOD1_STRM5 NADH-quinone oxidoreductase subunit D 1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoD1 PE=3 SV=1 86 473 2.0E-174
sp|A4SXQ0|NUOD_POLSQ NADH-quinone oxidoreductase subunit D OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=nuoD PE=3 SV=1 86 473 2.0E-174
sp|Q0KCS7|NUOD_CUPNH NADH-quinone oxidoreductase subunit D OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=nuoD PE=3 SV=1 87 473 2.0E-174
sp|Q5WT23|NUOD_LEGPL NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Lens) GN=nuoD PE=3 SV=1 86 473 2.0E-174
sp|Q5ZRU1|NUOD_LEGPH NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nuoD PE=3 SV=2 86 473 2.0E-174
sp|Q473U0|NUOD_CUPPJ NADH-quinone oxidoreductase subunit D OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nuoD PE=3 SV=1 87 473 3.0E-174
sp|B2FNX6|NUOD_STRMK NADH-quinone oxidoreductase subunit D OS=Stenotrophomonas maltophilia (strain K279a) GN=nuoD PE=3 SV=1 81 473 6.0E-174
sp|Q87EQ2|NUOD_XYLFT NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nuoD PE=3 SV=1 64 473 7.0E-174
sp|B2I787|NUOD_XYLF2 NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain M23) GN=nuoD PE=3 SV=1 64 473 7.0E-174
sp|B0U1W8|NUOD_XYLFM NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain M12) GN=nuoD PE=3 SV=1 64 473 8.0E-174
sp|Q2NA64|NUOD_ERYLH NADH-quinone oxidoreductase subunit D OS=Erythrobacter litoralis (strain HTCC2594) GN=nuoD PE=3 SV=1 87 473 1.0E-173
sp|B4SQT3|NUOD2_STRM5 NADH-quinone oxidoreductase subunit D 2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoD2 PE=3 SV=1 85 473 2.0E-173
sp|B1XUK1|NUOD_POLNS NADH-quinone oxidoreductase subunit D OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=nuoD PE=3 SV=1 86 473 4.0E-173
sp|B5EN68|NUOD_ACIF5 NADH-quinone oxidoreductase subunit D OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=nuoD PE=3 SV=1 86 473 5.0E-173
sp|A5IHW0|NUOD_LEGPC NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Corby) GN=nuoD PE=3 SV=1 86 473 5.0E-173
sp|Q5X1B0|NUOD_LEGPA NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Paris) GN=nuoD PE=3 SV=1 86 473 5.0E-173
sp|B6IZ48|NUOD_COXB2 NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain CbuG_Q212) GN=nuoD PE=3 SV=1 86 473 7.0E-173
sp|B6J697|NUOD_COXB1 NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain CbuK_Q154) GN=nuoD PE=3 SV=1 86 473 7.0E-173
sp|Q3BRN2|NUOD_XANC5 NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nuoD PE=3 SV=1 84 473 7.0E-173
sp|Q5GXT4|NUOD_XANOR NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nuoD PE=3 SV=1 84 473 9.0E-173
sp|B2SVL6|NUOD_XANOP NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=nuoD PE=3 SV=1 84 473 9.0E-173
sp|Q2P0V8|NUOD_XANOM NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nuoD PE=3 SV=1 84 473 9.0E-173
sp|A9KBK7|NUOD_COXBN NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nuoD PE=3 SV=3 86 473 1.0E-172
sp|Q8PJ43|NUOD_XANAC NADH-quinone oxidoreductase subunit D OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nuoD PE=3 SV=1 84 473 1.0E-172
sp|O07310|NUOD_RHOCA NADH-quinone oxidoreductase subunit D OS=Rhodobacter capsulatus GN=nuoD PE=3 SV=2 64 473 3.0E-172
sp|Q47HH3|NUOD_DECAR NADH-quinone oxidoreductase subunit D OS=Dechloromonas aromatica (strain RCB) GN=nuoD PE=3 SV=1 87 473 4.0E-172
sp|Q83BQ8|NUOD_COXBU NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nuoD PE=3 SV=1 86 473 5.0E-172
sp|A9N8X0|NUOD_COXBR NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nuoD PE=3 SV=1 86 473 5.0E-172
sp|Q8P7T5|NUOD_XANCP NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nuoD PE=3 SV=1 84 473 9.0E-172
sp|B0RRA1|NUOD_XANCB NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain B100) GN=nuoD PE=3 SV=1 84 473 9.0E-172
sp|Q4UWB5|NUOD_XANC8 NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nuoD PE=3 SV=1 84 473 9.0E-172
sp|A1AVR5|NUOD_RUTMC NADH-quinone oxidoreductase subunit D OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nuoD PE=3 SV=1 86 473 1.0E-171
sp|A9BNB1|NUOD_DELAS NADH-quinone oxidoreductase subunit D OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=nuoD PE=3 SV=1 86 473 2.0E-171
sp|B2IHW4|NUOD1_BEII9 NADH-quinone oxidoreductase subunit D 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoD1 PE=3 SV=1 82 473 2.0E-171
sp|Q23883|NDUS2_DICDI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium discoideum GN=nad7 PE=1 SV=1 83 473 3.0E-171
sp|Q2LCR5|NDUS2_DICCI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium citrinum GN=nad7 PE=3 SV=1 83 473 4.0E-171
sp|A5CXG0|NUOD_VESOH NADH-quinone oxidoreductase subunit D OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nuoD PE=3 SV=1 86 473 6.0E-171
sp|A1WXW4|NUOD_HALHL NADH-quinone oxidoreductase subunit D OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nuoD PE=3 SV=1 86 473 3.0E-167
sp|A0Q8G9|NUOD_FRATN NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. novicida (strain U112) GN=nuoD PE=3 SV=1 88 473 8.0E-165
sp|B0TWP7|NUOD_FRAP2 NADH-quinone oxidoreductase subunit D OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=nuoD PE=3 SV=1 88 473 1.0E-164
sp|A4IVZ5|NUOD_FRATW NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nuoD PE=3 SV=1 88 473 7.0E-164
sp|B2SEV2|NUOD_FRATM NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nuoD PE=3 SV=1 88 473 7.0E-164
sp|Q5NIN2|NUOD_FRATT NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nuoD PE=3 SV=1 88 473 2.0E-163
sp|Q14K35|NUOD_FRAT1 NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nuoD PE=3 SV=1 88 473 2.0E-163
sp|Q0BK54|NUOD_FRATO NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nuoD PE=3 SV=1 88 473 8.0E-163
sp|Q2A1F3|NUOD_FRATH NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nuoD PE=3 SV=1 88 473 8.0E-163
sp|A7NEK7|NUOD_FRATF NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nuoD PE=3 SV=1 88 473 8.0E-163
sp|A5G9B6|NUOD_GEOUR NADH-quinone oxidoreductase subunit D OS=Geobacter uraniireducens (strain Rf4) GN=nuoD PE=3 SV=1 91 473 8.0E-137
sp|A6UFK4|NUOD2_SINMW NADH-quinone oxidoreductase subunit D 2 OS=Sinorhizobium medicae (strain WSM419) GN=nuoD2 PE=3 SV=1 73 473 2.0E-134
sp|P56908|NUOD2_RHIME NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium meliloti (strain 1021) GN=nuoD2 PE=3 SV=2 73 473 4.0E-134
sp|Q74GA5|NUOD_GEOSL NADH-quinone oxidoreductase subunit D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoD PE=3 SV=1 91 473 1.0E-133
sp|B5YL34|NUOD2_THEYD NADH-quinone oxidoreductase subunit D 2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoD2 PE=3 SV=1 79 473 1.0E-133
sp|B5EFG0|NUOD_GEOBB NADH-quinone oxidoreductase subunit D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoD PE=3 SV=1 91 473 1.0E-133
sp|Q1IS35|NUOD2_KORVE NADH-quinone oxidoreductase subunit D 2 OS=Koribacter versatilis (strain Ellin345) GN=nuoD2 PE=3 SV=1 82 473 5.0E-133
sp|Q2K3U2|NUOD2_RHIEC NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoD2 PE=3 SV=1 73 473 5.0E-133
sp|Q39QB0|NUOD_GEOMG NADH-quinone oxidoreductase subunit D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoD PE=3 SV=1 91 473 1.0E-132
sp|B5YKI5|NUOD1_THEYD NADH-quinone oxidoreductase subunit D 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoD1 PE=3 SV=1 85 473 7.0E-132
sp|B3PY59|NUOD2_RHIE6 NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium etli (strain CIAT 652) GN=nuoD2 PE=3 SV=1 73 473 8.0E-132
sp|A9WFB4|NUOD2_CHLAA NADH-quinone oxidoreductase subunit D 2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoD2 PE=3 SV=1 67 473 9.0E-132
sp|B3E9W6|NUOD_GEOLS NADH-quinone oxidoreductase subunit D OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=nuoD PE=3 SV=1 91 473 5.0E-131
sp|A5UZH7|NUOD2_ROSS1 NADH-quinone oxidoreductase subunit D 2 OS=Roseiflexus sp. (strain RS-1) GN=nuoD2 PE=3 SV=1 92 473 1.0E-128
sp|A9B4Z7|NUOD1_HERA2 NADH-quinone oxidoreductase subunit D 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoD1 PE=3 SV=1 92 473 3.0E-128
sp|A7NIV9|NUOD1_ROSCS NADH-quinone oxidoreductase subunit D 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoD1 PE=3 SV=1 68 473 8.0E-128
sp|A0LRI4|NUOD_ACIC1 NADH-quinone oxidoreductase subunit D OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=nuoD PE=3 SV=1 59 473 2.0E-125
sp|B3DXN7|NUOD_METI4 NADH-quinone oxidoreductase subunit D OS=Methylacidiphilum infernorum (isolate V4) GN=nuoD PE=3 SV=1 92 473 1.0E-123
sp|P15689|NDUS2_PARTE NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Paramecium tetraurelia GN=NAD7 PE=3 SV=1 92 473 1.0E-123
sp|B2ULZ0|NUOD_AKKM8 NADH-quinone oxidoreductase subunit D OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=nuoD PE=3 SV=1 91 473 2.0E-121
sp|Q02CU0|NUOD1_SOLUE NADH-quinone oxidoreductase subunit D 1 OS=Solibacter usitatus (strain Ellin6076) GN=nuoD1 PE=3 SV=1 88 473 3.0E-121
sp|Q1D8S7|NUOD_MYXXD NADH-quinone oxidoreductase subunit D OS=Myxococcus xanthus (strain DK 1622) GN=nuoD PE=3 SV=1 86 473 2.0E-120
sp|Q0S447|NUOD_RHOJR NADH-quinone oxidoreductase subunit D OS=Rhodococcus jostii (strain RHA1) GN=nuoD PE=3 SV=1 92 473 5.0E-120
sp|B3QUS0|NUOD1_CHLT3 NADH-quinone oxidoreductase subunit D 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoD1 PE=3 SV=1 91 473 2.0E-119
sp|Q72GD1|NUOD_THET2 NADH-quinone oxidoreductase subunit D OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=nuoD PE=3 SV=1 68 473 3.0E-119
sp|Q82DX8|NUOD1_STRAW NADH-quinone oxidoreductase subunit D 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoD1 PE=3 SV=1 92 473 3.0E-119
sp|Q56220|NQO4_THET8 NADH-quinone oxidoreductase subunit 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo4 PE=1 SV=1 68 473 7.0E-119
sp|Q2S5J0|NUOD_SALRD NADH-quinone oxidoreductase subunit D OS=Salinibacter ruber (strain DSM 13855 / M31) GN=nuoD PE=3 SV=1 71 473 2.0E-118
sp|A4FPT8|NUOD_SACEN NADH-quinone oxidoreductase subunit D OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=nuoD PE=3 SV=1 50 473 2.0E-118
sp|Q1IS59|NUOD1_KORVE NADH-quinone oxidoreductase subunit D 1 OS=Koribacter versatilis (strain Ellin345) GN=nuoD1 PE=3 SV=1 91 473 3.0E-118
sp|Q01UN9|NUOD2_SOLUE NADH-quinone oxidoreductase subunit D 2 OS=Solibacter usitatus (strain Ellin6076) GN=nuoD2 PE=3 SV=1 91 473 3.0E-117
sp|A8Z6E5|NUOD_CAMC1 NADH-quinone oxidoreductase subunit D OS=Campylobacter concisus (strain 13826) GN=nuoD PE=3 SV=1 92 473 2.0E-116
sp|Q7MA48|NUOD_WOLSU NADH-quinone oxidoreductase subunit D OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nuoD PE=3 SV=1 71 473 2.0E-116
sp|Q9XAQ7|NUOD2_STRCO NADH-quinone oxidoreductase subunit D 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoD2 PE=3 SV=1 92 473 5.0E-116
sp|A8M619|NUOD1_SALAI NADH-quinone oxidoreductase subunit D 1 OS=Salinispora arenicola (strain CNS-205) GN=nuoD1 PE=3 SV=1 92 473 5.0E-116
sp|Q5YWD0|NUOD_NOCFA NADH-quinone oxidoreductase subunit D OS=Nocardia farcinica (strain IFM 10152) GN=nuoD PE=3 SV=1 31 473 1.0E-115
sp|A7H9V5|NUOD2_ANADF NADH-quinone oxidoreductase subunit D 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoD2 PE=3 SV=1 91 473 3.0E-115
sp|A5GCZ4|NUBCD_GEOUR NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter uraniireducens (strain Rf4) GN=nuoBCD PE=3 SV=1 92 473 4.0E-115
sp|Q47LE7|NUOD_THEFY NADH-quinone oxidoreductase subunit D OS=Thermobifida fusca (strain YX) GN=nuoD PE=3 SV=1 81 473 6.0E-115
sp|A8LC98|NUOD_FRASN NADH-quinone oxidoreductase subunit D OS=Frankia sp. (strain EAN1pec) GN=nuoD PE=3 SV=1 91 473 8.0E-115
sp|Q2IL06|NUOD1_ANADE NADH-quinone oxidoreductase subunit D 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=nuoD1 PE=3 SV=2 88 473 2.0E-114
sp|A4XC35|NUOD1_SALTO NADH-quinone oxidoreductase subunit D 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=nuoD1 PE=3 SV=1 91 473 4.0E-114
sp|Q0RRW5|NUOD_FRAAA NADH-quinone oxidoreductase subunit D OS=Frankia alni (strain ACN14a) GN=nuoD PE=3 SV=1 92 473 4.0E-114
sp|A7GW67|NUOD_CAMC5 NADH-quinone oxidoreductase subunit D OS=Campylobacter curvus (strain 525.92) GN=nuoD PE=3 SV=1 92 473 6.0E-114
sp|A4J657|NUOD_DESRM NADH-quinone oxidoreductase subunit D OS=Desulfotomaculum reducens (strain MI-1) GN=nuoD PE=3 SV=1 86 472 9.0E-114
sp|B4UIA9|NUOD2_ANASK NADH-quinone oxidoreductase subunit D 2 OS=Anaeromyxobacter sp. (strain K) GN=nuoD2 PE=3 SV=1 88 473 1.0E-113
sp|A7HZV1|NUOD_CAMHC NADH-quinone oxidoreductase subunit D OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=nuoD PE=3 SV=1 70 473 1.0E-113
sp|Q6MIR5|NUOCD_BDEBA NADH-quinone oxidoreductase subunit C/D OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nuoC PE=3 SV=1 59 473 4.0E-113
sp|A6QCG0|NUOD_SULNB NADH-quinone oxidoreductase subunit D OS=Sulfurovum sp. (strain NBC37-1) GN=nuoD PE=3 SV=1 91 473 6.0E-113
sp|O67335|NUCD2_AQUAE NADH-quinone oxidoreductase subunit C/D 2 OS=Aquifex aeolicus (strain VF5) GN=nuoC2 PE=3 SV=1 71 473 6.0E-113
sp|Q2JFL7|NUOD_FRASC NADH-quinone oxidoreductase subunit D OS=Frankia sp. (strain CcI3) GN=nuoD PE=3 SV=1 80 473 1.0E-112
sp|A1W1H5|NUOD_CAMJJ NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nuoD PE=3 SV=1 92 473 2.0E-112
sp|A6Q1P6|NUOD_NITSB NADH-quinone oxidoreductase subunit D OS=Nitratiruptor sp. (strain SB155-2) GN=nuoD PE=3 SV=1 79 473 5.0E-112
sp|Q608X9|NUOCD_METCA NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nuoC PE=3 SV=1 92 473 5.0E-112
sp|A7H5S8|NUOD_CAMJD NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nuoD PE=3 SV=1 92 473 7.0E-112
sp|A8FNN4|NUOD_CAMJ8 NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nuoD PE=3 SV=1 92 473 8.0E-112
sp|B1W516|NUOD1_STRGG NADH-quinone oxidoreductase subunit D 1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=nuoD1 PE=3 SV=1 75 473 2.0E-111
sp|B1ZRT0|NUOD1_OPITP NADH-quinone oxidoreductase subunit D 1 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=nuoD1 PE=3 SV=1 91 473 3.0E-111
sp|Q3A825|NUBCD_PELCD NADH-quinone oxidoreductase subunit B/C/D OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nuoBCD PE=3 SV=1 56 473 4.0E-111
sp|Q5HSL5|NUOD_CAMJR NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni (strain RM1221) GN=nuoD PE=3 SV=1 92 473 5.0E-111
sp|Q9PM99|NUOD_CAMJE NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nuoD PE=3 SV=1 92 473 5.0E-111
sp|A1ALP2|NUOD_PELPD NADH-quinone oxidoreductase subunit D OS=Pelobacter propionicus (strain DSM 2379) GN=nuoD1 PE=3 SV=1 89 473 1.0E-110
sp|Q6MDR3|NUOD_PARUW NADH-quinone oxidoreductase subunit D OS=Protochlamydia amoebophila (strain UWE25) GN=nuoD PE=3 SV=1 92 473 2.0E-110
sp|A9GUZ1|NUOD1_SORC5 NADH-quinone oxidoreductase subunit D 1 OS=Sorangium cellulosum (strain So ce56) GN=nuoD1 PE=3 SV=1 92 472 3.0E-110
sp|P9WJH5|NUOD_MYCTU NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoD PE=1 SV=1 92 473 8.0E-110
sp|P9WJH4|NUOD_MYCTO NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoD PE=3 SV=1 92 473 8.0E-110
sp|A5U7G4|NUOD_MYCTA NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nuoD PE=3 SV=1 92 473 8.0E-110
sp|A1KNE4|NUOD_MYCBP NADH-quinone oxidoreductase subunit D OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nuoD PE=3 SV=1 92 473 8.0E-110
sp|P65570|NUOD_MYCBO NADH-quinone oxidoreductase subunit D OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoD PE=3 SV=1 92 473 8.0E-110
sp|Q73V12|NUOD_MYCPA NADH-quinone oxidoreductase subunit D OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoD PE=3 SV=1 73 473 1.0E-109
sp|A0QJV0|NUOD_MYCA1 NADH-quinone oxidoreductase subunit D OS=Mycobacterium avium (strain 104) GN=nuoD PE=3 SV=1 73 473 1.0E-109
sp|Q1BBP6|NUOD_MYCSS NADH-quinone oxidoreductase subunit D OS=Mycobacterium sp. (strain MCS) GN=nuoD PE=3 SV=1 91 473 4.0E-109
sp|A1UDA1|NUOD_MYCSK NADH-quinone oxidoreductase subunit D OS=Mycobacterium sp. (strain KMS) GN=nuoD PE=3 SV=1 91 473 4.0E-109
sp|A3PWR8|NUOD_MYCSJ NADH-quinone oxidoreductase subunit D OS=Mycobacterium sp. (strain JLS) GN=nuoD PE=3 SV=1 91 473 4.0E-109
sp|A1SE30|NUOD_NOCSJ NADH-quinone oxidoreductase subunit D OS=Nocardioides sp. (strain BAA-499 / JS614) GN=nuoD PE=3 SV=1 79 473 5.0E-109
sp|B2UV27|NUOD_HELPS NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain Shi470) GN=nuoD PE=3 SV=1 92 473 7.0E-109
sp|A9WED7|NUOD1_CHLAA NADH-quinone oxidoreductase subunit D 1 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoD1 PE=3 SV=1 86 473 7.0E-109
sp|Q9ZJW4|NUOD_HELPJ NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nuoD PE=3 SV=1 92 473 7.0E-109
sp|B6JNA3|NUOD_HELP2 NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain P12) GN=nuoD PE=3 SV=1 92 473 7.0E-109
sp|Q1CRZ8|NUOD_HELPH NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain HPAG1) GN=nuoD PE=3 SV=1 92 473 7.0E-109
sp|O25853|NUOD_HELPY NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nuoD PE=3 SV=1 92 473 9.0E-109
sp|B5Z8Q8|NUOD_HELPG NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain G27) GN=nuoD PE=3 SV=1 92 473 1.0E-108
sp|Q746S4|NUBCD_GEOSL NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoBCD PE=3 SV=1 92 473 2.0E-108
sp|A5FXJ8|NUOCD_ACICJ NADH-quinone oxidoreductase subunit C/D OS=Acidiphilium cryptum (strain JF-5) GN=nuoC PE=3 SV=1 92 473 2.0E-108
sp|A5UXK3|NUOD1_ROSS1 NADH-quinone oxidoreductase subunit D 1 OS=Roseiflexus sp. (strain RS-1) GN=nuoD1 PE=3 SV=1 86 473 3.0E-108
sp|Q17Z55|NUOD_HELAH NADH-quinone oxidoreductase subunit D OS=Helicobacter acinonychis (strain Sheeba) GN=nuoD PE=3 SV=1 91 473 4.0E-108
sp|A9HN95|NUOCD_GLUDA NADH-quinone oxidoreductase subunit C/D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoC PE=3 SV=1 92 473 5.0E-108
sp|B1MPG7|NUOD_MYCA9 NADH-quinone oxidoreductase subunit D OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=nuoD PE=3 SV=1 91 473 7.0E-108
sp|A0QU33|NUOD_MYCS2 NADH-quinone oxidoreductase subunit D OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nuoD PE=3 SV=1 91 473 8.0E-108
sp|Q1IZX0|NUOD_DEIGD NADH-quinone oxidoreductase subunit D OS=Deinococcus geothermalis (strain DSM 11300) GN=nuoD PE=3 SV=1 64 473 1.0E-107
sp|Q39ZC4|NUBCD_GEOMG NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoBCD PE=3 SV=1 92 473 1.0E-107
sp|A0PR41|NUOD_MYCUA NADH-quinone oxidoreductase subunit D OS=Mycobacterium ulcerans (strain Agy99) GN=nuoD PE=3 SV=1 92 473 2.0E-107
sp|B0TH80|NUOD_HELMI NADH-quinone oxidoreductase subunit D OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=nuoD PE=3 SV=1 86 472 2.0E-107
sp|Q2YAA3|NUOCD_NITMU NADH-quinone oxidoreductase subunit C/D OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoC PE=3 SV=1 92 473 2.0E-107
sp|Q67KN9|NUOD2_SYMTH NADH-quinone oxidoreductase subunit D 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoD2 PE=3 SV=1 86 473 2.0E-107
sp|A7NL07|NUOD2_ROSCS NADH-quinone oxidoreductase subunit D 2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoD2 PE=3 SV=1 86 473 3.0E-107
sp|B4U8I3|NUOCD_HYDS0 NADH-quinone oxidoreductase subunit C/D OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=nuoC PE=3 SV=1 70 473 3.0E-107
sp|B2HGE5|NUOD_MYCMM NADH-quinone oxidoreductase subunit D OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=nuoD PE=3 SV=1 92 473 3.0E-107
sp|Q30PI1|NUOD_SULDN NADH-quinone oxidoreductase subunit D OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nuoD PE=3 SV=1 79 473 3.0E-107
sp|Q7VFS5|NUOD_HELHP NADH-quinone oxidoreductase subunit D OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nuoD PE=3 SV=1 83 473 4.0E-107
sp|Q9RU89|NUOD_DEIRA NADH-quinone oxidoreductase subunit D OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nuoD PE=3 SV=1 91 473 1.0E-106
sp|A4TDA8|NUOD_MYCGI NADH-quinone oxidoreductase subunit D OS=Mycobacterium gilvum (strain PYR-GCK) GN=nuoD PE=3 SV=1 77 473 1.0E-105
sp|Q5KUJ8|NUOD_GEOKA NADH-quinone oxidoreductase subunit D OS=Geobacillus kaustophilus (strain HTA426) GN=nuoD PE=3 SV=1 86 472 1.0E-105
sp|Q3JC17|NUOCD_NITOC NADH-quinone oxidoreductase subunit C/D OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoC PE=3 SV=1 92 473 2.0E-105
sp|O66826|NUCD1_AQUAE NADH-quinone oxidoreductase subunit C/D 1 OS=Aquifex aeolicus (strain VF5) GN=nuoC1 PE=3 SV=1 70 473 2.0E-105
sp|Q3Z7Z8|NUOD_DEHM1 NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=nuoD PE=3 SV=1 86 473 5.0E-105
sp|A1T6A3|NUOD_MYCVP NADH-quinone oxidoreductase subunit D OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=nuoD PE=3 SV=1 72 473 1.0E-104
sp|A4ITI4|NUOD_GEOTN NADH-quinone oxidoreductase subunit D OS=Geobacillus thermodenitrificans (strain NG80-2) GN=nuoD PE=3 SV=1 86 472 2.0E-104
sp|Q07QX3|NUOCD_RHOP5 NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoC PE=3 SV=1 82 473 3.0E-104
sp|B1X4A5|NDHH_PAUCH NAD(P)H-quinone oxidoreductase subunit H, organellar chromatophore OS=Paulinella chromatophora GN=ndhH PE=3 SV=1 92 473 4.0E-104
sp|B4EZC8|NUOCD_PROMH NADH-quinone oxidoreductase subunit C/D OS=Proteus mirabilis (strain HI4320) GN=nuoC PE=3 SV=1 92 473 4.0E-104
sp|A4XV04|NUOCD_PSEMY NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas mendocina (strain ymp) GN=nuoC PE=3 SV=1 92 473 8.0E-104
sp|A1JLG6|NUOCD_YERE8 NADH-quinone oxidoreductase subunit C/D OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nuoC PE=3 SV=1 92 473 1.0E-103
sp|Q13BH3|NUOCD_RHOPS NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoC PE=3 SV=1 92 473 2.0E-103
sp|A5FQY6|NUOD_DEHMB NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=nuoD PE=3 SV=1 86 473 2.0E-103
sp|B1KJV0|NUOCD_SHEWM NADH-quinone oxidoreductase subunit C/D OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nuoC PE=3 SV=1 84 473 2.0E-103
sp|Q7N2I9|NUOCD_PHOLL NADH-quinone oxidoreductase subunit C/D OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nuoC PE=3 SV=1 92 473 2.0E-103
sp|B5E972|NUBCD_GEOBB NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoBCD PE=3 SV=1 92 473 3.0E-103
sp|B1JGL5|NUOCD_YERPY NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|Q669A2|NUOCD_YERPS NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|A4TM34|NUOCD_YERPP NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis (strain Pestoides F) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|Q1CHQ3|NUOCD_YERPN NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|Q7CJ92|NUOCD_YERPE NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|B2K819|NUOCD_YERPB NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|Q1C6B1|NUOCD_YERPA NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|A7FGQ7|NUOCD_YERP3 NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nuoC PE=3 SV=1 92 473 4.0E-103
sp|Q8M9T5|NDHH_CHAGL NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chaetosphaeridium globosum GN=ndhH PE=3 SV=1 84 473 4.0E-103
sp|A9R6L8|NUOCD_YERPG NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nuoC PE=3 SV=1 92 473 5.0E-103
sp|Q7VRV4|NUOCD_BLOFL NADH-quinone oxidoreductase subunit C/D OS=Blochmannia floridanus GN=nuoC PE=3 SV=1 53 473 6.0E-103
sp|A4WCR5|NUOCD_ENT38 NADH-quinone oxidoreductase subunit C/D OS=Enterobacter sp. (strain 638) GN=nuoC PE=3 SV=1 92 473 1.0E-102
sp|Q2J0F1|NUOCD_RHOP2 NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoC PE=3 SV=1 92 473 2.0E-102
sp|Q3ZXR8|NUOD_DEHMC NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain CBDB1) GN=nuoD PE=3 SV=1 86 473 2.0E-102
sp|Q1LT91|NUOCD_BAUCH NADH-quinone oxidoreductase subunit C/D OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=nuoC PE=3 SV=1 84 473 3.0E-102
sp|B3Q6T3|NUOCD_RHOPT NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoC PE=3 SV=1 92 473 8.0E-102
sp|A9VS95|NUOD_BACWK NADH-quinone oxidoreductase subunit D OS=Bacillus weihenstephanensis (strain KBAB4) GN=nuoD PE=3 SV=1 92 472 9.0E-102
sp|Q3AC80|NUOD_CARHZ NADH-quinone oxidoreductase subunit D OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nuoD PE=3 SV=1 86 472 1.0E-101
sp|Q6N1Z0|NUOCD_RHOPA NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoC PE=3 SV=1 92 473 1.0E-101
sp|A6V4E7|NUOCD_PSEA7 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain PA7) GN=nuoC PE=3 SV=1 92 473 2.0E-101
sp|Q9I0J9|NUOCD_PSEAE NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoC PE=3 SV=1 92 473 2.0E-101
sp|Q02ND1|NUOCD_PSEAB NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nuoC PE=3 SV=1 92 473 2.0E-101
sp|C3JY83|NUOCD_PSEFS NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain SBW25) GN=nuoC PE=3 SV=1 77 473 2.0E-101
sp|A7GV48|NUOD_BACCN NADH-quinone oxidoreductase subunit D OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=nuoD PE=3 SV=1 92 472 3.0E-101
sp|A8GH14|NUOCD_SERP5 NADH-quinone oxidoreductase subunit C/D OS=Serratia proteamaculans (strain 568) GN=nuoC PE=3 SV=1 92 473 4.0E-101
sp|B0SP85|NUOD_LEPBP NADH-quinone oxidoreductase subunit D OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=nuoD PE=3 SV=1 89 472 5.0E-101
sp|B0SFT7|NUOD_LEPBA NADH-quinone oxidoreductase subunit D OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=nuoD PE=3 SV=1 89 472 5.0E-101
sp|Q8F7Q2|NUOD_LEPIN NADH-quinone oxidoreductase subunit D OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=nuoD PE=3 SV=1 74 472 8.0E-101
sp|Q72NT5|NUOD_LEPIC NADH-quinone oxidoreductase subunit D OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=nuoD PE=3 SV=1 74 472 8.0E-101
sp|A0KJ65|NUOCD_AERHH NADH-quinone oxidoreductase subunit C/D OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=nuoC PE=3 SV=1 84 473 1.0E-100
sp|C5B8I4|NUOCD_EDWI9 NADH-quinone oxidoreductase subunit C/D OS=Edwardsiella ictaluri (strain 93-146) GN=nuoC PE=3 SV=1 92 473 1.0E-100
sp|Q4K9T4|NUOCD_PSEF5 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nuoC PE=3 SV=1 92 473 2.0E-100
sp|Q81K03|NUOD_BACAN NADH-quinone oxidoreductase subunit D OS=Bacillus anthracis GN=nuoD PE=3 SV=1 92 472 3.0E-100
sp|Q814W9|NUOD_BACCR NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=nuoD PE=3 SV=1 92 472 4.0E-100
sp|Q04V69|NUOD_LEPBJ NADH-quinone oxidoreductase subunit D OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=nuoD PE=3 SV=1 74 472 4.0E-100
sp|Q3J1Q7|NUOCD_RHOS4 NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoC PE=3 SV=1 92 473 5.0E-100
sp|Q3KA61|NUOCD_PSEPF NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain Pf0-1) GN=nuoC PE=3 SV=1 92 473 5.0E-100
sp|Q04YA7|NUOD_LEPBL NADH-quinone oxidoreductase subunit D OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=nuoD PE=3 SV=1 74 472 6.0E-100
sp|A0LEQ1|NUOD_SYNFM NADH-quinone oxidoreductase subunit D OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoD PE=3 SV=1 90 473 6.0E-100
sp|B9KJI1|NUOCD_RHOSK NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=nuoC PE=3 SV=1 92 473 7.0E-100
sp|B4TPK8|NUOCD_SALSV NADH-quinone oxidoreductase subunit C/D OS=Salmonella schwarzengrund (strain CVM19633) GN=nuoC PE=3 SV=1 92 473 8.0E-100
sp|B5BCM0|NUOCD_SALPK NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi A (strain AKU_12601) GN=nuoC PE=3 SV=1 92 473 8.0E-100
sp|A9N582|NUOCD_SALPB NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nuoC PE=3 SV=1 92 473 8.0E-100
sp|Q5PN53|NUOCD_SALPA NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nuoC PE=3 SV=1 92 473 8.0E-100
sp|B5EZK7|NUOCD_SALA4 NADH-quinone oxidoreductase subunit C/D OS=Salmonella agona (strain SL483) GN=nuoC PE=3 SV=1 92 473 8.0E-100
sp|Q2JWB1|NDHH_SYNJA NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain JA-3-3Ab) GN=ndhH PE=3 SV=1 82 473 8.0E-100
sp|A8ADV3|NUOCD_CITK8 NADH-quinone oxidoreductase subunit C/D OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nuoC PE=3 SV=1 92 473 9.0E-100
sp|B4SYZ7|NUOCD_SALNS NADH-quinone oxidoreductase subunit C/D OS=Salmonella newport (strain SL254) GN=nuoC PE=3 SV=1 92 473 9.0E-100
sp|A9MJ99|NUOCD_SALAR NADH-quinone oxidoreductase subunit C/D OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nuoC PE=3 SV=1 92 473 9.0E-100
sp|Q67P19|NUOD1_SYMTH NADH-quinone oxidoreductase subunit D 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoD1 PE=3 SV=1 82 473 9.0E-100
sp|P0A1Y6|NUOCD_SALTY NADH-quinone oxidoreductase subunit C/D OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoC PE=3 SV=2 92 473 1.0E-99
sp|P0A1Y7|NUOCD_SALTI NADH-quinone oxidoreductase subunit C/D OS=Salmonella typhi GN=nuoC PE=3 SV=2 92 473 1.0E-99
sp|B4TBJ2|NUOCD_SALHS NADH-quinone oxidoreductase subunit C/D OS=Salmonella heidelberg (strain SL476) GN=nuoC PE=3 SV=2 92 473 1.0E-99
sp|B5RCF1|NUOCD_SALG2 NADH-quinone oxidoreductase subunit C/D OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nuoC PE=3 SV=2 92 473 1.0E-99
sp|B5R307|NUOCD_SALEP NADH-quinone oxidoreductase subunit C/D OS=Salmonella enteritidis PT4 (strain P125109) GN=nuoC PE=3 SV=2 92 473 1.0E-99
sp|B5FPG7|NUOCD_SALDC NADH-quinone oxidoreductase subunit C/D OS=Salmonella dublin (strain CT_02021853) GN=nuoC PE=3 SV=2 92 473 1.0E-99
sp|A3PKI2|NUOCD_RHOS1 NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoC PE=3 SV=1 92 473 1.0E-99
sp|P33599|NUOCD_ECOLI NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12) GN=nuoC PE=1 SV=3 92 473 1.0E-99
sp|A0RL88|NUOD_BACAH NADH-quinone oxidoreductase subunit D OS=Bacillus thuringiensis (strain Al Hakam) GN=nuoD PE=3 SV=1 92 472 1.0E-99
sp|C6DA44|NUOCD_PECCP NADH-quinone oxidoreductase subunit C/D OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nuoC PE=3 SV=1 92 473 1.0E-99
sp|B1X8Z8|NUOCD_ECODH NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12 / DH10B) GN=nuoC PE=3 SV=1 92 473 2.0E-99
sp|A0LJM5|NUBCD_SYNFM NADH-quinone oxidoreductase subunit B/C/D OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoBCD PE=3 SV=1 91 473 2.0E-99
sp|Q0T2K1|NUOCD_SHIF8 NADH-quinone oxidoreductase subunit C/D OS=Shigella flexneri serotype 5b (strain 8401) GN=nuoC PE=3 SV=1 92 473 2.0E-99
sp|Q0TFG0|NUOCD_ECOL5 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nuoC PE=3 SV=1 92 473 2.0E-99
sp|C1DL16|NUOCD_AZOVD NADH-quinone oxidoreductase subunit C/D OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=nuoC PE=3 SV=1 92 473 3.0E-99
sp|B1J6N2|NUOCD_PSEPW NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain W619) GN=nuoC PE=3 SV=1 69 473 3.0E-99
sp|Q2JN25|NDHH_SYNJB NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ndhH PE=3 SV=1 82 473 3.0E-99
sp|A6TBX2|NUOCD_KLEP7 NADH-quinone oxidoreductase subunit C/D OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nuoC PE=3 SV=1 92 473 3.0E-99
sp|B5XNV6|NUOCD_KLEP3 NADH-quinone oxidoreductase subunit C/D OS=Klebsiella pneumoniae (strain 342) GN=nuoC PE=3 SV=1 92 473 3.0E-99
sp|Q88FH5|NUOCD_PSEPK NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain KT2440) GN=nuoC PE=3 SV=1 69 473 3.0E-99
sp|A5W190|NUOCD_PSEP1 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nuoC PE=3 SV=1 69 473 3.0E-99
sp|Q6D2R9|NUOCD_PECAS NADH-quinone oxidoreductase subunit C/D OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|A7MH24|NUOCD_CROS8 NADH-quinone oxidoreductase subunit C/D OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|Q3YZS4|NUOCD_SHISS NADH-quinone oxidoreductase subunit C/D OS=Shigella sonnei (strain Ss046) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|Q83QS6|NUOCD_SHIFL NADH-quinone oxidoreductase subunit C/D OS=Shigella flexneri GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|Q32DQ3|NUOCD_SHIDS NADH-quinone oxidoreductase subunit C/D OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|Q31YH5|NUOCD_SHIBS NADH-quinone oxidoreductase subunit C/D OS=Shigella boydii serotype 4 (strain Sb227) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B7LM46|NUOCD_ESCF3 NADH-quinone oxidoreductase subunit C/D OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B1LLN9|NUOCD_ECOSM NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B6I7N6|NUOCD_ECOSE NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain SE11) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B7N5P8|NUOCD_ECOLU NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B1IXQ6|NUOCD_ECOLC NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|A8A2F5|NUOCD_ECOHS NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O9:H4 (strain HS) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B7M5W5|NUOCD_ECO8A NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O8 (strain IAI1) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B7NNW5|NUOCD_ECO7I NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B7LAU8|NUOCD_ECO55 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain 55989 / EAEC) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|A7ZPA0|NUOCD_ECO24 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nuoC PE=3 SV=1 92 473 4.0E-99
sp|B0KMY0|NUOCD_PSEPG NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain GB-1) GN=nuoC PE=3 SV=1 69 473 4.0E-99
sp|Q6HAY8|NUOD_BACHK NADH-quinone oxidoreductase subunit D OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=nuoD PE=3 SV=1 92 472 4.0E-99
sp|Q0I6T6|NDHH_SYNS3 NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9311) GN=ndhH PE=3 SV=1 91 473 5.0E-99
sp|Q20Z41|NUOCD_RHOPB NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoC PE=3 SV=1 92 473 5.0E-99
sp|Q87ZQ7|NUOCD_PSESM NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoC PE=3 SV=1 92 473 5.0E-99
sp|A9B480|NUOD2_HERA2 NADH-quinone oxidoreductase subunit D 2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoD2 PE=3 SV=1 86 473 6.0E-99
sp|B2TW67|NUOCD_SHIB3 NADH-quinone oxidoreductase subunit C/D OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nuoC PE=3 SV=1 92 473 6.0E-99
sp|Q1R9D1|NUOCD_ECOUT NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain UTI89 / UPEC) GN=nuoC PE=3 SV=1 92 473 7.0E-99
sp|Q8FFJ7|NUOCD_ECOL6 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoC PE=3 SV=1 92 473 7.0E-99
sp|A1ADD4|NUOCD_ECOK1 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O1:K1 / APEC GN=nuoC PE=3 SV=1 92 473 7.0E-99
sp|B7MXG5|NUOCD_ECO81 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O81 (strain ED1a) GN=nuoC PE=3 SV=1 92 473 7.0E-99
sp|B7MG50|NUOCD_ECO45 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nuoC PE=3 SV=1 92 473 7.0E-99
sp|B7UFU4|NUOCD_ECO27 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nuoC PE=3 SV=1 92 473 7.0E-99
sp|Q8KEC0|NUOD_CHLTE NADH-quinone oxidoreductase subunit D OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=nuoD PE=3 SV=2 89 473 7.0E-99
sp|Q1I7Z8|NUOCD_PSEE4 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas entomophila (strain L48) GN=nuoC PE=3 SV=1 69 473 8.0E-99
sp|A4SLP2|NUOCD_AERS4 NADH-quinone oxidoreductase subunit C/D OS=Aeromonas salmonicida (strain A449) GN=nuoC PE=3 SV=1 84 473 8.0E-99
sp|Q492H8|NUOCD_BLOPB NADH-quinone oxidoreductase subunit C/D OS=Blochmannia pennsylvanicus (strain BPEN) GN=nuoC PE=3 SV=1 92 473 9.0E-99
sp|Q72XF6|NUOD_BACC1 NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nuoD PE=3 SV=1 92 472 1.0E-98
sp|Q2NSK1|NUOCD_SODGM NADH-quinone oxidoreductase subunit C/D OS=Sodalis glossinidius (strain morsitans) GN=nuoC PE=3 SV=1 92 473 1.0E-98
sp|A4WT70|NUOCD_RHOS5 NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoC PE=3 SV=1 92 473 1.0E-98
sp|Q8EI31|NUOCD_SHEON NADH-quinone oxidoreductase subunit C/D OS=Shewanella oneidensis (strain MR-1) GN=nuoC PE=3 SV=1 84 473 1.0E-98
sp|C0Q041|NUOCD_SALPC NADH-quinone oxidoreductase subunit C/D OS=Salmonella paratyphi C (strain RKS4594) GN=nuoC PE=3 SV=1 92 473 1.0E-98
sp|Q2RJU4|NUOD_MOOTA NADH-quinone oxidoreductase subunit D OS=Moorella thermoacetica (strain ATCC 39073) GN=nuoD PE=3 SV=1 81 473 1.0E-98
sp|Q7VE17|NDHH_PROMA NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ndhH PE=3 SV=1 91 473 1.0E-98
sp|Q57M30|NUOCD_SALCH NADH-quinone oxidoreductase subunit C/D OS=Salmonella choleraesuis (strain SC-B67) GN=nuoC PE=3 SV=2 92 473 1.0E-98
sp|Q48H52|NUOCD_PSE14 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nuoC PE=3 SV=1 92 473 2.0E-98
sp|Q4ZRJ1|NUOCD_PSEU2 NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nuoC PE=3 SV=1 92 473 2.0E-98
sp|B3QP55|NUOD_CHLP8 NADH-quinone oxidoreductase subunit D OS=Chlorobaculum parvum (strain NCIB 8327) GN=nuoD PE=3 SV=1 89 473 2.0E-98
sp|B8D761|NUOCD_BUCAT NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=nuoC PE=3 SV=1 83 473 2.0E-98
sp|P57254|NUOCD_BUCAI NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoC PE=3 SV=1 83 473 2.0E-98
sp|A6LXQ2|NUOD_CLOB8 NADH-quinone oxidoreductase subunit D OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nuoD PE=3 SV=1 91 473 2.0E-98
sp|A5GP75|NDHH_SYNPW NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain WH7803) GN=ndhH PE=3 SV=1 91 473 3.0E-98
sp|B8D8V7|NUOCD_BUCA5 NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=nuoC PE=3 SV=1 83 473 3.0E-98
sp|B2V8J2|NUOCD_SULSY NADH-quinone oxidoreductase subunit C/D OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=nuoC PE=3 SV=1 86 473 3.0E-98
sp|B5YXS6|NUOCD_ECO5E NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nuoC PE=3 SV=1 92 473 4.0E-98
sp|Q8XCW9|NUOCD_ECO57 NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli O157:H7 GN=nuoC PE=3 SV=1 92 473 4.0E-98
sp|B4SBZ0|NUOD_PELPB NADH-quinone oxidoreductase subunit D OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=nuoD PE=3 SV=1 94 473 6.0E-98
sp|Q630V1|NUOD_BACCZ NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ZK / E33L) GN=nuoD PE=3 SV=1 92 472 9.0E-98
sp|Q3AVZ9|NDHH_SYNS9 NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9902) GN=ndhH PE=3 SV=1 91 473 1.0E-97
sp|Q7TUL1|NDHH_PROMM NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9313) GN=ndhH PE=3 SV=1 91 473 1.0E-97
sp|Q19V59|NDHH_CHLAT NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chlorokybus atmophyticus GN=ndhH PE=3 SV=2 91 473 1.0E-97
sp|P12131|NDHH_MARPO NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Marchantia polymorpha GN=ndhH PE=3 SV=1 86 473 2.0E-97
sp|Q6A6G1|NUOD_PROAC NADH-quinone oxidoreductase subunit D OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nuoD PE=3 SV=1 92 473 2.0E-97
sp|Q3AGW8|NDHH_SYNSC NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9605) GN=ndhH PE=3 SV=1 91 473 2.0E-97
sp|Q9MUL0|NDHH_MESVI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Mesostigma viride GN=ndhH PE=3 SV=1 91 473 3.0E-97
sp|Q7U3X8|NDHH_SYNPX NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain WH8102) GN=ndhH PE=3 SV=1 91 473 4.0E-97
sp|A9L9F3|NDHH_LEMMI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lemna minor GN=ndhH PE=3 SV=1 80 473 5.0E-97
sp|A2CD94|NDHH_PROM3 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9303) GN=ndhH PE=3 SV=1 91 473 7.0E-97
sp|B2VIV5|NUOCD_ERWT9 NADH-quinone oxidoreductase subunit C/D OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nuoC PE=3 SV=1 92 473 7.0E-97
sp|A2C001|NDHH_PROM1 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain NATL1A) GN=ndhH PE=3 SV=1 91 473 8.0E-97
sp|Q46HK0|NDHH_PROMT NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain NATL2A) GN=ndhH PE=3 SV=1 91 473 8.0E-97
sp|Q32S01|NDHH_STAPU NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Staurastrum punctulatum GN=ndhH PE=3 SV=1 92 473 2.0E-96
sp|A2T389|NDHH_ANGEV NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Angiopteris evecta GN=ndhH PE=3 SV=1 92 473 2.0E-96
sp|B2J184|NDHH_NOSP7 NAD(P)H-quinone oxidoreductase subunit H OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ndhH PE=3 SV=1 91 473 2.0E-96
sp|A8ERL4|NUOCD_ARCB4 NADH-quinone oxidoreductase subunit C/D OS=Arcobacter butzleri (strain RM4018) GN=nuoC PE=3 SV=1 92 473 3.0E-96
sp|B3QY45|NUOD2_CHLT3 NADH-quinone oxidoreductase subunit D 2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoD2 PE=3 SV=1 89 473 3.0E-96
sp|Q6YXP7|NDHH_PHYPA NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Physcomitrella patens subsp. patens GN=ndhH PE=3 SV=1 86 473 4.0E-96
sp|Q85UU0|NDHH_ANTFO NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Anthoceros formosae GN=ndhH PE=2 SV=1 91 473 5.0E-96
sp|Q7NI12|NDHH1_GLOVI NAD(P)H-quinone oxidoreductase subunit H 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=ndhH1 PE=3 SV=1 81 473 8.0E-96
sp|Q1ACE3|NDHH_CHAVU NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chara vulgaris GN=ndhH PE=3 SV=1 85 473 9.0E-96
sp|Q1QST4|NUOCD_CHRSD NADH-quinone oxidoreductase subunit C/D OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=nuoC PE=3 SV=1 92 473 9.0E-96
sp|P25709|NDHH_MAIZE NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Zea mays GN=ndhH PE=3 SV=1 92 473 1.0E-95
sp|Q1QD95|NUOCD_PSYCK NADH-quinone oxidoreductase subunit C/D OS=Psychrobacter cryohalolentis (strain K5) GN=nuoC PE=3 SV=1 92 473 1.0E-95
sp|Q89AU4|NUOCD_BUCBP NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoC PE=3 SV=1 60 473 2.0E-95
sp|Q4FU62|NUOCD_PSYA2 NADH-quinone oxidoreductase subunit C/D OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=nuoC PE=3 SV=1 92 473 2.0E-95
sp|Q8K9Y5|NUOCD_BUCAP NADH-quinone oxidoreductase subunit C/D OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoC PE=3 SV=1 83 473 2.0E-95
sp|Q8DJD9|NDHH_THEEB NAD(P)H-quinone oxidoreductase subunit H OS=Thermosynechococcus elongatus (strain BP-1) GN=ndhH PE=3 SV=1 91 473 3.0E-95
sp|A4SF45|NUOD_CHLPM NADH-quinone oxidoreductase subunit D OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=nuoD PE=3 SV=1 83 473 3.0E-95
sp|P27724|NDHH_SYNY3 NAD(P)H-quinone oxidoreductase subunit H OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ndhH PE=1 SV=3 91 473 3.0E-95
sp|A1EA65|NDHH_AGRST NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Agrostis stolonifera GN=ndhH-A PE=3 SV=1 92 473 3.0E-95
sp|Q10VG2|NDHH_TRIEI NAD(P)H-quinone oxidoreductase subunit H OS=Trichodesmium erythraeum (strain IMS101) GN=ndhH PE=3 SV=1 91 473 4.0E-95
sp|Q8YRT8|NDHH_NOSS1 NAD(P)H-quinone oxidoreductase subunit H OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ndhH PE=3 SV=1 91 473 4.0E-95
sp|Q7V3B0|NDHH_PROMP NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ndhH PE=3 SV=1 91 473 4.0E-95
sp|A5WG46|NUOCD_PSYWF NADH-quinone oxidoreductase subunit C/D OS=Psychrobacter sp. (strain PRwf-1) GN=nuoC PE=3 SV=1 92 473 4.0E-95
sp|A3PAP0|NDHH_PROM0 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9301) GN=ndhH PE=3 SV=1 91 473 4.0E-95
sp|B0BZ27|NDHH_ACAM1 NAD(P)H-quinone oxidoreductase subunit H OS=Acaryochloris marina (strain MBIC 11017) GN=ndhH PE=3 SV=1 91 473 5.0E-95
sp|A2BUE9|NDHH_PROM5 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9515) GN=ndhH PE=3 SV=1 91 473 7.0E-95
sp|Q31D09|NDHH_PROM9 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9312) GN=ndhH PE=3 SV=1 91 473 8.0E-95
sp|A2BNW7|NDHH_PROMS NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain AS9601) GN=ndhH PE=3 SV=1 91 473 8.0E-95
sp|A8G2H8|NDHH_PROM2 NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9215) GN=ndhH PE=3 SV=1 91 473 8.0E-95
sp|Q3B4W0|NUOD_CHLL7 NADH-quinone oxidoreductase subunit D OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=nuoD PE=3 SV=1 91 473 1.0E-94
sp|Q6ENP1|NDHH_SACOF NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Saccharum officinarum GN=ndhH PE=3 SV=1 92 473 1.0E-94
[Show less]

GO

GO Term Description Terminal node
GO:0048038 quinone binding Yes
GO:0016651 oxidoreductase activity, acting on NAD(P)H Yes
GO:0051287 NAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4846
MAALHSVVGRAARRLRLRPTMTVRLATRSLSTTCPRLYASPEPMGTKLVPVDDDLAHPSDPYGMNRDPLDPSVTE
ESREGSVENRKVRHYTVNFGPQHPAAHGVLRLILELRGEEIIRADPHVGLLHRGTEKLIEYKTYLQALPYFDRLD
YVSMMTNEQCFALAVEKLLNIEIPDRAKYIRTLFGEITRVLNHLMSVLSHAMDVGALTPFLWGFEEREKLMEFYE
RVSGARLHAAYVRPGGVHQDLPLGLLDDIYQWATQFGDRIDETEEMLTDNRIWIERLRGIGVVSAAEALNLSFSG
VMLRGSGVPWDIRKSQPYDAYDKVEFDVPVGVNGDCYDRYLCRMEEFRQSLRIIYQCLNQMPPGPVRVEDYKISP
PPRAAMKENMEALIHHFLLYTKGYAVPPGETYSVIEAPKGEMGVYLVSDGSERPYRCHIRAPGFAHLAGFDHISR
GHLLADAVAVIGTMDLVFGEVDR*
Coding >Ophun1|4846
ATGGCAGCCCTTCACAGCGTCGTCGGCCGGGCCGCCAGGCGTCTCCGTCTGAGGCCGACGATGACGGTCCGTCTC
GCCACCCGATCTCTATCCACGACCTGTCCTCGCCTCTACGCCTCGCCCGAGCCCATGGGCACCAAGCTCGTGCCC
GTCGATGACGACCTCGCTCACCCCAGCGACCCTTACGGCATGAACCGCGATCCTCTCGATCCTAGTGTCACTGAG
GAGTCGCGCGAGGGCTCGGTTGAGAACCGCAAGGTGCGGCATTATACTGTCAACTTTGGCCCGCAGCATCCGGCT
GCCCATGGCGTCTTGCGCCTCATCCTCGAGCTCAGGGGAGAGGAGATCATTCGCGCAGATCCGCACGTTGGCTTG
CTGCATCGGGGCACTGAGAAGCTCATCGAGTACAAGACGTATCTTCAGGCCTTGCCTTACTTTGACCGTCTCGAC
TACGTCTCCATGATGACCAACGAGCAATGCTTCGCCCTCGCTGTCGAGAAGCTGCTCAACATTGAGATCCCGGAT
CGAGCCAAGTACATCCGCACACTGTTTGGCGAAATCACCCGTGTCCTCAATCATCTCATGTCTGTTCTGTCCCAT
GCCATGGACGTCGGCGCCTTGACCCCTTTTCTTTGGGGCTTTGAGGAGCGAGAGAAGCTCATGGAATTCTACGAG
CGCGTATCAGGTGCTCGTCTTCACGCCGCATACGTTCGCCCCGGCGGTGTCCATCAGGATCTCCCACTCGGCCTG
CTCGATGACATCTATCAGTGGGCCACCCAGTTCGGCGATCGCATCGACGAAACGGAGGAGATGCTCACTGACAAC
CGCATCTGGATCGAGCGGTTGAGAGGCATCGGTGTTGTCTCCGCCGCCGAGGCCCTCAACCTCTCCTTCTCCGGC
GTCATGCTTCGCGGTTCCGGCGTTCCATGGGACATCCGAAAGAGCCAGCCATACGACGCCTACGACAAGGTCGAG
TTTGACGTGCCCGTCGGCGTCAACGGTGACTGCTACGACCGCTATCTCTGCCGCATGGAAGAGTTCCGCCAGTCA
CTCCGCATCATCTATCAATGCCTCAACCAGATGCCCCCTGGCCCCGTTCGGGTCGAGGACTACAAGATCTCGCCT
CCGCCCCGCGCCGCCATGAAGGAGAACATGGAGGCTCTGATTCATCACTTCCTTCTGTATACAAAGGGTTACGCC
GTTCCTCCTGGCGAGACGTACTCGGTCATCGAGGCGCCCAAGGGCGAGATGGGTGTTTACCTCGTCAGCGATGGC
AGCGAGCGTCCTTATCGATGTCACATTCGGGCCCCAGGCTTCGCCCACTTGGCCGGTTTCGATCACATCTCGAGG
GGTCACCTGCTGGCCGACGCTGTGGCCGTCATCGGCACTATGGACCTGGTGTTTGGTGAGGTTGATCGGTAG
Transcript >Ophun1|4846
ATGGCAGCCCTTCACAGCGTCGTCGGCCGGGCCGCCAGGCGTCTCCGTCTGAGGCCGACGATGACGGTCCGTCTC
GCCACCCGATCTCTATCCACGACCTGTCCTCGCCTCTACGCCTCGCCCGAGCCCATGGGCACCAAGCTCGTGCCC
GTCGATGACGACCTCGCTCACCCCAGCGACCCTTACGGCATGAACCGCGATCCTCTCGATCCTAGTGTCACTGAG
GAGTCGCGCGAGGGCTCGGTTGAGAACCGCAAGGTGCGGCATTATACTGTCAACTTTGGCCCGCAGCATCCGGCT
GCCCATGGCGTCTTGCGCCTCATCCTCGAGCTCAGGGGAGAGGAGATCATTCGCGCAGATCCGCACGTTGGCTTG
CTGCATCGGGGCACTGAGAAGCTCATCGAGTACAAGACGTATCTTCAGGCCTTGCCTTACTTTGACCGTCTCGAC
TACGTCTCCATGATGACCAACGAGCAATGCTTCGCCCTCGCTGTCGAGAAGCTGCTCAACATTGAGATCCCGGAT
CGAGCCAAGTACATCCGCACACTGTTTGGCGAAATCACCCGTGTCCTCAATCATCTCATGTCTGTTCTGTCCCAT
GCCATGGACGTCGGCGCCTTGACCCCTTTTCTTTGGGGCTTTGAGGAGCGAGAGAAGCTCATGGAATTCTACGAG
CGCGTATCAGGTGCTCGTCTTCACGCCGCATACGTTCGCCCCGGCGGTGTCCATCAGGATCTCCCACTCGGCCTG
CTCGATGACATCTATCAGTGGGCCACCCAGTTCGGCGATCGCATCGACGAAACGGAGGAGATGCTCACTGACAAC
CGCATCTGGATCGAGCGGTTGAGAGGCATCGGTGTTGTCTCCGCCGCCGAGGCCCTCAACCTCTCCTTCTCCGGC
GTCATGCTTCGCGGTTCCGGCGTTCCATGGGACATCCGAAAGAGCCAGCCATACGACGCCTACGACAAGGTCGAG
TTTGACGTGCCCGTCGGCGTCAACGGTGACTGCTACGACCGCTATCTCTGCCGCATGGAAGAGTTCCGCCAGTCA
CTCCGCATCATCTATCAATGCCTCAACCAGATGCCCCCTGGCCCCGTTCGGGTCGAGGACTACAAGATCTCGCCT
CCGCCCCGCGCCGCCATGAAGGAGAACATGGAGGCTCTGATTCATCACTTCCTTCTGTATACAAAGGGTTACGCC
GTTCCTCCTGGCGAGACGTACTCGGTCATCGAGGCGCCCAAGGGCGAGATGGGTGTTTACCTCGTCAGCGATGGC
AGCGAGCGTCCTTATCGATGTCACATTCGGGCCCCAGGCTTCGCCCACTTGGCCGGTTTCGATCACATCTCGAGG
GGTCACCTGCTGGCCGACGCTGTGGCCGTCATCGGCACTATGGACCTGGTGTTTGGTGAGGTTGATCGGTAG
Gene >Ophun1|4846
ATGGCAGCCCTTCACAGCGTCGTCGGCCGGGCCGCCAGGCGTCTCCGTCTGAGGCCGACGATGACGGTCCGTCTC
GCCACCCGATCTCTATCCACGACCTGTCCTCGCCTCTACGCCTCGCCCGAGCCCATGGGCACCAAGCTCGTGCCC
GTCGATGACGACCTCGCTCACCCCAGCGACCCTTACGGCATGAACCGCGATCCTCTCGATCCTAGTGTCACTGAG
GAGTCGCGCGAGGGCTCGGTTGAGAACCGCAAGGTGCGGCATTATACTGTCAACTTTGGCCCGCAGCATCCGGCT
GCCCATGGCGTCTTGCGCCTCATCCTCGAGCTCAGGGGAGAGGAGATCATTCGCGCAGATCCGCACGTTGGCTTG
CTGCATCGGGGCACTGAGAAGCTCATCGAGTACAAGACGTATCTTCAGGCCTTGCCTTACTTTGACCGTCTCGAC
TACGTCTCCATGATGACCAACGAGCAATGCTTCGCCCTCGCTGTCGAGAAGCTGCTCAACATTGAGATCCCGGAT
CGAGCCAAGTACATCCGCACACTGTTTGGCGAAATCACCCGTGTCCTCAATCATCTCATGTCTGTTCTGTCCCAT
GCCATGGACGTCGGCGCCTTGACCCCTTTTCTTTGGGGCTTTGAGGAGCGAGAGAAGCTCATGGTTCGTCAGCTG
CATTACGTCAAACTGATCAGCCACTTACCTTGATCTTCAGGAATTCTACGAGCGCGTATCAGGTGCTCGTCTTCA
CGCCGCATACGTTCGCCCCGGCGGTGTCCATCAGGATCTCCCACTCGGCCTGCTCGATGACATCTATCAGTGGGC
CACCCAGTTCGGCGATCGCATCGACGAAACGGAGGAGATGCTCACTGACAACCGCATCTGGATCGAGCGGTTGAG
AGGCATCGGTGTTGTCTCCGCCGCCGAGGCCCTCAACCTCTCCTTCTCCGGCGTCATGCTTCGCGGTTCCGGCGT
TCCATGGGACATCCGAAAGAGCCAGCCATACGACGCCTACGACAAGGTCGAGTTTGACGTGCCCGTCGGCGTCAA
CGGTGACTGCTACGACCGCTATCTCTGCCGCATGGAAGAGTTCCGCCAGTCACTCCGCATCATCTATCAATGCCT
CAACCAGATGCCCCCTGGCCCCGTTCGGGTCGAGGACTACAAGATCTCGCCTCCGCCCCGCGCCGCCATGAAGGA
GAACATGGAGGCTCTGATTCATCACTTCCTTCTGTATACAAAGGGTTACGCCGTTCCTCCTGGCGAGACGTACTC
GGTCATCGAGGCGCCCAAGGGCGAGATGGGTGTTTACCTCGTCAGCGATGGCAGCGAGCGTCCTTATCGATGTCA
CATTCGGGCCCCAGGCTTCGCCCACTTGGCCGGTTTCGATCACATCTCGAGGGGTCACCTGCTGGCCGACGCTGT
GGCCGTCATCGGCACTATGGACCTGGTGTTTGGTAAGTGCGGTAGAGACTCTCGAGGGACGCGGTCCAGCTGACT
TCTGAATCCAGGTGAGGTTGATCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail