Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|484
Gene name
LocationContig_114:8176..9558
Strand-
Gene length (bp)1382
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999749

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6546
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06954
Ophiocordyceps camponoti-rufipedis Ophun1|484 (this protein)
Ophiocordyceps kimflemingae Ophio5|5546
Ophiocordyceps subramaniannii Hirsu2|20

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|484
MTNNLCTGLMVLVSTVSALSSPWEDACFGDMKHIFRDNIKEACYGFAKGNMTEVGLEKLCRIEGGRFNLDKCSAT
MSILSTNCGTKLQAITRSCQLRYPELKHPYCVEDACYQQMTDHFQGSIEKACDEMLDDSTVLRRYAQSLNGGCGR
SMATVKSVCNCVRPAETTMIYDEKRCLEGMQSQFGAGTGVMCHRLMTETTFWENYKIFLFDICGQDMNIIRSACK
WDNKLLGFNKCLEKSCYRGLAQTYDHTQISDVCSAVIDRSFTQGQLKAVPQLARQCGGSLEELRSACFCVYPAER
YPHCGADDCFRGIASDWGEDIEANCRTVLTRNFTDSSEPECKNELEGLVQESKWLGLQTHAFDQCGKDQAKLEKA
CRCVLPDVEEGPQRCEDHELYTEAETDGFSSAAVQLEEEILDEDFEGEMEVGDDDCSDGFYG*
Coding >Ophun1|484
ATGACGAATAATCTCTGCACAGGGCTCATGGTCCTCGTCAGCACCGTCTCAGCCCTCTCCTCACCTTGGGAAGAC
GCATGCTTCGGCGACATGAAGCACATCTTCAGAGACAACATCAAGGAGGCGTGCTACGGCTTCGCAAAGGGGAAC
ATGACCGAGGTAGGGCTCGAGAAACTGTGCAGAATCGAGGGGGGTAGATTCAACCTGGATAAATGCTCGGCCACC
ATGTCCATCTTGTCGACCAACTGCGGCACAAAGCTTCAAGCCATCACAAGAAGCTGCCAACTTCGATACCCAGAA
CTCAAGCATCCGTACTGCGTCGAGGATGCCTGCTACCAGCAGATGACGGATCACTTCCAGGGTTCCATCGAAAAG
GCATGTGACGAGATGCTGGACGATAGCACGGTCCTTCGCCGTTACGCGCAGTCTCTCAACGGTGGCTGCGGAAGA
AGCATGGCGACGGTCAAGTCAGTCTGCAACTGCGTTCGTCCAGCAGAAACGACCATGATATACGACGAGAAGCGG
TGTCTCGAAGGAATGCAGAGCCAGTTCGGCGCAGGAACGGGCGTCATGTGCCACCGACTCATGACCGAAACCACC
TTTTGGGAAAACTACAAAATCTTCCTCTTCGACATCTGCGGCCAGGACATGAACATTATCCGATCAGCCTGCAAG
TGGGACAACAAACTCCTCGGCTTCAACAAGTGTCTGGAGAAGAGCTGCTACCGCGGCCTGGCACAGACGTACGAC
CACACTCAGATCTCAGACGTCTGCAGCGCCGTCATCGACCGCTCTTTTACGCAGGGGCAGCTCAAGGCCGTGCCC
CAGCTGGCGAGGCAGTGCGGAGGGAGCCTCGAGGAGCTGAGATCGGCCTGCTTCTGCGTCTACCCTGCTGAGCGG
TATCCTCACTGCGGTGCGGACGATTGCTTCAGGGGCATTGCTTCGGATTGGGGGGAGGATATCGAGGCCAACTGT
CGGACTGTTCTTACCCGCAACTTCACGGATAGCTCTGAGCCCGAGTGCAAGAATGAGCTTGAGGGCTTGGTCCAG
GAGTCGAAGTGGCTGGGGCTGCAGACGCATGCCTTTGATCAGTGCGGTAAAGACCAGGCGAAGCTGGAAAAGGCC
TGTCGATGTGTCTTGCCTGATGTTGAGGAGGGTCCGCAGCGCTGCGAGGATCACGAGCTCTACACGGAGGCCGAG
ACCGACGGCTTCTCGTCGGCGGCCGTCCAGCTCGAAGAGGAAATCTTGGACGAGGACTTCGAGGGCGAGATGGAG
GTCGGGGATGACGACTGCTCGGACGGCTTCTACGGTTGA
Transcript >Ophun1|484
ATGACGAATAATCTCTGCACAGGGCTCATGGTCCTCGTCAGCACCGTCTCAGCCCTCTCCTCACCTTGGGAAGAC
GCATGCTTCGGCGACATGAAGCACATCTTCAGAGACAACATCAAGGAGGCGTGCTACGGCTTCGCAAAGGGGAAC
ATGACCGAGGTAGGGCTCGAGAAACTGTGCAGAATCGAGGGGGGTAGATTCAACCTGGATAAATGCTCGGCCACC
ATGTCCATCTTGTCGACCAACTGCGGCACAAAGCTTCAAGCCATCACAAGAAGCTGCCAACTTCGATACCCAGAA
CTCAAGCATCCGTACTGCGTCGAGGATGCCTGCTACCAGCAGATGACGGATCACTTCCAGGGTTCCATCGAAAAG
GCATGTGACGAGATGCTGGACGATAGCACGGTCCTTCGCCGTTACGCGCAGTCTCTCAACGGTGGCTGCGGAAGA
AGCATGGCGACGGTCAAGTCAGTCTGCAACTGCGTTCGTCCAGCAGAAACGACCATGATATACGACGAGAAGCGG
TGTCTCGAAGGAATGCAGAGCCAGTTCGGCGCAGGAACGGGCGTCATGTGCCACCGACTCATGACCGAAACCACC
TTTTGGGAAAACTACAAAATCTTCCTCTTCGACATCTGCGGCCAGGACATGAACATTATCCGATCAGCCTGCAAG
TGGGACAACAAACTCCTCGGCTTCAACAAGTGTCTGGAGAAGAGCTGCTACCGCGGCCTGGCACAGACGTACGAC
CACACTCAGATCTCAGACGTCTGCAGCGCCGTCATCGACCGCTCTTTTACGCAGGGGCAGCTCAAGGCCGTGCCC
CAGCTGGCGAGGCAGTGCGGAGGGAGCCTCGAGGAGCTGAGATCGGCCTGCTTCTGCGTCTACCCTGCTGAGCGG
TATCCTCACTGCGGTGCGGACGATTGCTTCAGGGGCATTGCTTCGGATTGGGGGGAGGATATCGAGGCCAACTGT
CGGACTGTTCTTACCCGCAACTTCACGGATAGCTCTGAGCCCGAGTGCAAGAATGAGCTTGAGGGCTTGGTCCAG
GAGTCGAAGTGGCTGGGGCTGCAGACGCATGCCTTTGATCAGTGCGGTAAAGACCAGGCGAAGCTGGAAAAGGCC
TGTCGATGTGTCTTGCCTGATGTTGAGGAGGGTCCGCAGCGCTGCGAGGATCACGAGCTCTACACGGAGGCCGAG
ACCGACGGCTTCTCGTCGGCGGCCGTCCAGCTCGAAGAGGAAATCTTGGACGAGGACTTCGAGGGCGAGATGGAG
GTCGGGGATGACGACTGCTCGGACGGCTTCTACGGTTGA
Gene >Ophun1|484
ATGACGAATAATCTCTGCACAGGGCTCATGGTCCTCGTCAGCACCGTCTCAGCCCTCTCCTCACCTTGGGAAGAC
GCATGCTTCGGCGACATGAAGCACATCTTCAGAGACAACATCAAGGAGGCGTGCTACGGCTTCGCAAAGGGGAAC
ATGACCGAGGTAGGGCTCGAGAAACTGTGCAGAATCGAGGGGGGTAGATTCAACCTGGATAAATGCTCGGCCACC
ATGTCCATCTTGTCGACCAACTGCGGCACAAAGCTTCAAGCCATCACAAGAAGCTGCCAACTTCGATACCCAGAA
CTCAAGCATCCGTACTGCGTCGAGGATGCCTGCTACCAGCAGATGACGGATCACTTCCAGGGTTCCATCGAAAAG
GCATGTGACGAGATGCTGGACGATAGCACGGTCCTTCGCCGTTACGCGCAGTCTCTCAACGGTGGCTGCGGAAGA
AGCATGGCGACGGTCAAGTCAGTCTGCAACTGCGTTCGTCCAGCAGAAACGACCATGATATACGACGAGAAGCGG
TGTCTCGAAGGAATGCAGAGCCAGTTCGGCGCAGGAACGGGCGTCATGTGCCACCGACTCATGACCGAAACCACC
TTTTGGGAAAACTACAAAATCTTCCTCTTCGACATCTGCGGCCAGGACATGAACATTATCCGATCAGCCTGCAAG
TGGGACAACAAACTCCTCGGCTTCAACAAGTGTCTGGAGAAGAGCTGCTACCGCGGCCTGGCACAGACGTACGAC
CACACTCAGATCTCAGACGTCTGCAGCGCCGTCATCGACCGCTCTTTTACGCAGGGGCAGCTCAAGGCCGTGCCC
CAGCTGGCGAGGCAGTGCGGAGGGAGCCTCGAGGAGCTGAGATCGGCCTGCTTCTGCGTCTACCCTGCTGAGCGG
TATCCTCACTGCGGTGCGGACGATTGCTTCAGGGGCATTGCTTCGGATTGGGGGGAGGATATCGAGGCCAACTGT
CGGACTGTTCTTACCCGCAACTTCACGGATAGCTCTGAGCCCGAGTGCAAGAATGAGCTTGAGGGCTTGGTCCAG
GAGTCGAAGTGGCTGGGGCTGCAGACGCATGCCTTTGATCAGTGCGGTAAAGACCAGGCGAAGCTGGAAAAGGCC
TGTCGATGTGTCTTGCCTGATGTTGAGGAGGGTCCGGTGAGGAACACCAGCAGTGTGTTGAGCACCAGCTCTACT
GCGTTTGTCTCGAGCTCCACGGTTGTTAGCAGCGCTGCGAGGATCACGAGCTCTACACGGAGGCCGAGACCGACG
GCTTCTCGTCGGCGGCCGTCCAGCTCGAAGAGGAAATCTTGGACGAGGACTTCGAGGGCGAGATGGAGGTCGGGG
ATGACGACTGCTCGGACGGCTTCTACGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail