Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4837
Gene name
LocationContig_457:2052..2568
Strand-
Gene length (bp)516
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4988
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4511
Ophiocordyceps camponoti-floridani Ophcf2|03893
Ophiocordyceps camponoti-rufipedis Ophun1|4837 (this protein)
Ophiocordyceps kimflemingae Ophio5|7202
Ophiocordyceps subramaniannii Hirsu2|2274
Ophiocordyceps subramaniannii Hirsu2|256

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4837
MVYHKQKREEEGCVKPQLAKAKSKAGKQSRHSSTPRTSKEVIRQRRSKANKPGPAKAVEHRQTTQHNVDAPTTFR
VNASTASVFATLFDRSESRGAVRWAAFEAAMADLGFTVMPQFGSIYRFEPPGNRGFSNAFSVHRPHRSRMENYKI
HPLARQLRDLYGWSAKTFEVV*
Coding >Ophun1|4837
ATGGTCTATCACAAGCAGAAACGTGAGGAGGAGGGCTGTGTCAAGCCGCAACTCGCCAAAGCCAAGTCCAAGGCT
GGGAAACAGTCGAGGCACTCGTCAACCCCAAGGACGAGCAAGGAGGTCATCCGACAACGGCGAAGCAAGGCCAAC
AAACCGGGACCCGCGAAAGCGGTCGAGCATCGGCAAACCACGCAACACAACGTCGATGCCCCAACGACGTTCCGA
GTCAACGCATCGACAGCCAGCGTCTTCGCCACGCTGTTTGACCGATCCGAGTCGCGGGGGGCCGTCAGATGGGCG
GCCTTTGAGGCGGCAATGGCGGACCTGGGCTTCACCGTCATGCCGCAATTCGGGTCAATTTACAGGTTCGAGCCC
CCAGGGAACAGGGGCTTCAGCAACGCGTTTTCCGTGCATCGACCACACAGGTCTCGCATGGAAAACTACAAGATC
CATCCCTTGGCGCGCCAGCTGAGGGATCTTTACGGATGGAGCGCAAAGACGTTTGAAGTTGTTTGA
Transcript >Ophun1|4837
ATGGTCTATCACAAGCAGAAACGTGAGGAGGAGGGCTGTGTCAAGCCGCAACTCGCCAAAGCCAAGTCCAAGGCT
GGGAAACAGTCGAGGCACTCGTCAACCCCAAGGACGAGCAAGGAGGTCATCCGACAACGGCGAAGCAAGGCCAAC
AAACCGGGACCCGCGAAAGCGGTCGAGCATCGGCAAACCACGCAACACAACGTCGATGCCCCAACGACGTTCCGA
GTCAACGCATCGACAGCCAGCGTCTTCGCCACGCTGTTTGACCGATCCGAGTCGCGGGGGGCCGTCAGATGGGCG
GCCTTTGAGGCGGCAATGGCGGACCTGGGCTTCACCGTCATGCCGCAATTCGGGTCAATTTACAGGTTCGAGCCC
CCAGGGAACAGGGGCTTCAGCAACGCGTTTTCCGTGCATCGACCACACAGGTCTCGCATGGAAAACTACAAGATC
CATCCCTTGGCGCGCCAGCTGAGGGATCTTTACGGATGGAGCGCAAAGACGTTTGAAGTTGTTTGA
Gene >Ophun1|4837
ATGGTCTATCACAAGCAGAAACGTGAGGAGGAGGGCTGTGTCAAGCCGCAACTCGCCAAAGCCAAGTCCAAGGCT
GGGAAACAGTCGAGGCACTCGTCAACCCCAAGGACGAGCAAGGAGGTCATCCGACAACGGCGAAGCAAGGCCAAC
AAACCGGGACCCGCGAAAGCGGTCGAGCATCGGCAAACCACGCAACACAACGTCGATGCCCCAACGACGTTCCGA
GTCAACGCATCGACAGCCAGCGTCTTCGCCACGCTGTTTGACCGATCCGAGTCGCGGGGGGCCGTCAGATGGGCG
GCCTTTGAGGCGGCAATGGCGGACCTGGGCTTCACCGTCATGCCGCAATTCGGGTCAATTTACAGGTTCGAGCCC
CCAGGGAACAGGGGCTTCAGCAACGCGTTTTCCGTGCATCGACCACACAGGTCTCGCATGGAAAACTACAAGATC
CATCCCTTGGCGCGCCAGCTGAGGGATCTTTACGGATGGAGCGCAAAGACGTTTGAAGTTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail