Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4836
Gene name
LocationContig_457:145..1245
Strand+
Gene length (bp)1100
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3712
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7841
Ophiocordyceps australis map64 (Brazil) OphauB2|6467
Ophiocordyceps camponoti-floridani Ophcf2|03894
Ophiocordyceps camponoti-rufipedis Ophun1|4836 (this protein)
Ophiocordyceps kimflemingae Ophio5|7203
Ophiocordyceps subramaniannii Hirsu2|7230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4836
MPNLHVPSPPDFLNESPPAADPSPEASPTPDDIVLLRAALHRAKGLPPDIVDCIFDFAEFWARSSSVVNYGNEMR
QSKSIVASCPQENTFLLRSPPLGLTHVCRGNVRLAEELVYDSSEARPIPLTRERDAAYFSRLVDYPTPRLVNPCR
KIVFSIRSRDQGWGTHDGDEKCTYDARRDSSTETPPALPVCGLRPVQPTINVLTDQDETRYLYDHPLLPDDRYNI
CRNKAACPDWQDHVVTWSYLDDVEPTSDAGADLHQKGRGRASADGSFVRGLRLGDVVTVWGKARFPQWINKVESV
HIDVYWAV*
Coding >Ophun1|4836
ATGCCCAACCTCCACGTCCCCAGCCCTCCCGACTTCCTGAACGAATCCCCCCCAGCAGCAGACCCCTCCCCCGAA
GCGAGCCCTACGCCCGACGACATCGTCCTGTTGCGCGCGGCGCTGCATCGCGCAAAGGGCCTTCCGCCTGATATC
GTCGACTGCATCTTTGACTTTGCCGAGTTTTGGGCGCGGTCGTCTTCTGTGGTCAACTATGGCAACGAGATGCGG
CAGAGCAAGAGCATCGTTGCTTCGTGTCCGCAGGAGAACACCTTTCTCCTTCGCTCTCCGCCTCTTGGTCTGACG
CACGTCTGTCGTGGAAATGTCCGTCTGGCAGAAGAACTGGTGTATGACTCGAGCGAGGCGCGGCCCATCCCCTTG
ACGCGGGAACGCGACGCTGCATATTTCTCTCGTTTGGTCGATTATCCGACGCCCAGACTGGTCAACCCCTGTCGA
AAGATTGTCTTTTCCATCAGGAGTCGTGATCAGGGTTGGGGCACCCACGATGGTGATGAAAAGTGCACTTATGAC
GCCCGCCGCGATTCGTCGACCGAGACTCCTCCAGCCCTCCCCGTCTGCGGCCTCCGCCCCGTCCAGCCAACAATA
AATGTCCTGACCGACCAGGACGAGACGCGCTATCTGTACGACCACCCCCTCCTCCCCGATGATCGTTACAACATC
TGCCGCAACAAAGCTGCCTGTCCCGATTGGCAAGACCACGTCGTCACCTGGTCCTACCTAGACGACGTCGAGCCC
ACCTCTGACGCCGGCGCCGATCTCCATCAGAAGGGACGAGGCCGCGCCTCGGCAGACGGCTCTTTTGTTCGTGGT
CTGAGACTTGGCGACGTCGTCACCGTCTGGGGCAAGGCCCGCTTCCCGCAGTGGATTAATAAGGTTGAGTCGGTT
CACATCGACGTTTACTGGGCTGTGTGA
Transcript >Ophun1|4836
ATGCCCAACCTCCACGTCCCCAGCCCTCCCGACTTCCTGAACGAATCCCCCCCAGCAGCAGACCCCTCCCCCGAA
GCGAGCCCTACGCCCGACGACATCGTCCTGTTGCGCGCGGCGCTGCATCGCGCAAAGGGCCTTCCGCCTGATATC
GTCGACTGCATCTTTGACTTTGCCGAGTTTTGGGCGCGGTCGTCTTCTGTGGTCAACTATGGCAACGAGATGCGG
CAGAGCAAGAGCATCGTTGCTTCGTGTCCGCAGGAGAACACCTTTCTCCTTCGCTCTCCGCCTCTTGGTCTGACG
CACGTCTGTCGTGGAAATGTCCGTCTGGCAGAAGAACTGGTGTATGACTCGAGCGAGGCGCGGCCCATCCCCTTG
ACGCGGGAACGCGACGCTGCATATTTCTCTCGTTTGGTCGATTATCCGACGCCCAGACTGGTCAACCCCTGTCGA
AAGATTGTCTTTTCCATCAGGAGTCGTGATCAGGGTTGGGGCACCCACGATGGTGATGAAAAGTGCACTTATGAC
GCCCGCCGCGATTCGTCGACCGAGACTCCTCCAGCCCTCCCCGTCTGCGGCCTCCGCCCCGTCCAGCCAACAATA
AATGTCCTGACCGACCAGGACGAGACGCGCTATCTGTACGACCACCCCCTCCTCCCCGATGATCGTTACAACATC
TGCCGCAACAAAGCTGCCTGTCCCGATTGGCAAGACCACGTCGTCACCTGGTCCTACCTAGACGACGTCGAGCCC
ACCTCTGACGCCGGCGCCGATCTCCATCAGAAGGGACGAGGCCGCGCCTCGGCAGACGGCTCTTTTGTTCGTGGT
CTGAGACTTGGCGACGTCGTCACCGTCTGGGGCAAGGCCCGCTTCCCGCAGTGGATTAATAAGGTTGAGTCGGTT
CACATCGACGTTTACTGGGCTGTGTGA
Gene >Ophun1|4836
ATGCCCAACCTCCACGTCCCCAGCCCTCCCGACTTCCTGAACGAATCCCCCCCAGCAGCAGACCCCTCCCCCGAA
GCGAGCCCTACGCCCGACGACATCGTCCTGTTGCGCGCGGCGCTGCATCGCGCAAAGGGCCTTCCGCCTGATATC
GTCGACTGCATCTTTGACTTTGCCGAGTTTTGGGCGCGGTCGTCTTCTGTGGTCAACTATGGCAACGAGATGCGG
CAGAGCAAGAGCATCGTTGCTTCGTGTCCGCAGGAGAACACCTTTCTCGTATGTGAGGCCCCTGACGTCTCCTCG
TTCTTCTCTGACTTGGTCTTTCTTCCAGCTTCGCTCTCCGCCTCTTGGTCTGACGCACGTCTGTCGTGGAAATGT
CCGTCTGGCAGAAGAACTGGTGTATGACTCGAGCGAGGCGCGGCCCATCCCCTTGACGCGGGAACGCGACGCTGC
ATATTTCTCTCGTTTGGTCGATTATCCGACGCCCAGACTGGTCAACCCCTGTCGAAAGATTGTCTTTTCCATCAG
GAGTCGTGATCAGGGTTGGGGCACCCACGATGGTACTTATACGAGTTCCTGGACCTGGTTCGAAGCTGGTCTCGA
ACGCTTCGATGCTGCTCAAGAGTGCAAGTCCCCCCTCGCTTCATGGTTAGATTCATACTGACTTTGTGTCTTAAG
GTGATGAAAAGTGCACTTATGACGCCCGCCGCGATTCGTCGACCGAGACTCCTCCAGCCCTCCCCGTCTGCGGCC
TCCGCCCCGTCCAGCCAACAATAAATGTCCTGACCGACCAGGACGAGACGCGCTATCTGTACGACCACCCCCTCC
TCCCCGATGATCGTTACAACATCTGCCGCAACAAAGCTGCCTGTCCCGATTGGCAAGACCACGTCGTCACCTGGT
CCTACCTAGACGACGTCGAGCCCACCTCTGACGCCGGCGCCGATCTCCATCAGAAGGGACGAGGCCGCGCCTCGG
CAGACGGCTCTTTTGTTCGTGGTCTGAGACTTGGCGACGTCGTCACCGTCTGGGGCAAGGCCCGCTTCCCGCAGT
GGATTAATAAGGTTGAGTCGGTTCACATCGACGTTTACTGGGCTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail