Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4835
Gene name
LocationContig_456:4538..5651
Strand-
Gene length (bp)1113
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06966 DUF1295 Protein of unknown function (DUF1295) 4.6E-57 26 257
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 8.5E-07 143 209

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 41 59 18
3 66 88 22
4 108 127 19
5 140 162 22
6 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4835
MATVHVLDNYYLAITALVTIAYQLLFFSIAYTFKFDKLTDLAGGSNFAVLAILTLSLSGQHHARQVVASLFLIIW
AVRLSGFLFFRILKTGSDDRFDDKRDKFFPFLGFWIFQMLWVWTVSLPVTVLNSPNVTQYPQHSFGTGRDIAGIV
LFVIGFLMEAVSDVQKYRFRQSHDKRSVCNKGLFAVSRHPNYFGEIIIQFSIYMIAVSSAADGYVSGQAYKALYA
TILGPFFLTILLMFVSGLPLSERPKAKSRYEKGNNWFEYEDWLQRTSILIPFPPQLYAKMPVFLKRTIFLEFPMY
VFDPAKHSEHSFPGGASETADERGRHGGDERLA*
Coding >Ophun1|4835
ATGGCAACCGTCCACGTCCTGGACAATTACTACCTCGCCATCACCGCCCTCGTAACCATAGCCTACCAACTCCTC
TTCTTCTCCATCGCCTACACCTTCAAGTTCGACAAGCTAACCGACCTCGCCGGCGGCTCCAACTTCGCCGTCCTC
GCCATCCTCACCCTCTCCCTCTCGGGCCAACATCATGCCCGCCAGGTCGTAGCCTCCCTCTTCCTCATCATCTGG
GCCGTCCGCCTCTCCGGCTTCCTCTTCTTCCGCATCCTCAAAACCGGCTCCGATGACCGCTTCGATGACAAGCGC
GACAAGTTCTTCCCGTTTCTTGGCTTCTGGATCTTTCAGATGCTCTGGGTTTGGACCGTCTCTTTGCCCGTTACT
GTCCTCAACTCGCCCAACGTGACGCAGTATCCGCAGCATTCCTTTGGTACGGGCAGGGATATCGCAGGCATTGTC
CTCTTTGTCATCGGCTTTCTCATGGAGGCTGTCAGCGACGTGCAAAAGTATCGCTTCCGTCAGTCTCACGACAAG
AGATCCGTCTGCAACAAGGGCCTCTTTGCCGTCTCGCGCCATCCCAACTACTTTGGCGAAATCATCATTCAATTC
TCCATCTACATGATTGCCGTCTCCTCCGCCGCCGACGGCTACGTCAGCGGTCAAGCCTACAAGGCCCTCTACGCC
ACCATCCTGGGCCCCTTCTTCCTCACCATCCTTCTCATGTTCGTCTCCGGCCTACCGCTGTCAGAGCGGCCCAAG
GCCAAATCACGGTACGAAAAGGGCAACAACTGGTTCGAGTACGAAGACTGGCTCCAGCGGACCAGCATCCTCATC
CCCTTTCCGCCCCAGCTGTACGCCAAGATGCCTGTCTTCCTCAAGCGCACCATCTTCCTCGAGTTCCCCATGTAC
GTCTTCGACCCTGCCAAACACTCGGAGCACTCTTTTCCGGGCGGCGCTTCCGAGACGGCCGATGAGCGGGGACGA
CATGGTGGCGACGAGAGGCTGGCCTAA
Transcript >Ophun1|4835
ATGGCAACCGTCCACGTCCTGGACAATTACTACCTCGCCATCACCGCCCTCGTAACCATAGCCTACCAACTCCTC
TTCTTCTCCATCGCCTACACCTTCAAGTTCGACAAGCTAACCGACCTCGCCGGCGGCTCCAACTTCGCCGTCCTC
GCCATCCTCACCCTCTCCCTCTCGGGCCAACATCATGCCCGCCAGGTCGTAGCCTCCCTCTTCCTCATCATCTGG
GCCGTCCGCCTCTCCGGCTTCCTCTTCTTCCGCATCCTCAAAACCGGCTCCGATGACCGCTTCGATGACAAGCGC
GACAAGTTCTTCCCGTTTCTTGGCTTCTGGATCTTTCAGATGCTCTGGGTTTGGACCGTCTCTTTGCCCGTTACT
GTCCTCAACTCGCCCAACGTGACGCAGTATCCGCAGCATTCCTTTGGTACGGGCAGGGATATCGCAGGCATTGTC
CTCTTTGTCATCGGCTTTCTCATGGAGGCTGTCAGCGACGTGCAAAAGTATCGCTTCCGTCAGTCTCACGACAAG
AGATCCGTCTGCAACAAGGGCCTCTTTGCCGTCTCGCGCCATCCCAACTACTTTGGCGAAATCATCATTCAATTC
TCCATCTACATGATTGCCGTCTCCTCCGCCGCCGACGGCTACGTCAGCGGTCAAGCCTACAAGGCCCTCTACGCC
ACCATCCTGGGCCCCTTCTTCCTCACCATCCTTCTCATGTTCGTCTCCGGCCTACCGCTGTCAGAGCGGCCCAAG
GCCAAATCACGGTACGAAAAGGGCAACAACTGGTTCGAGTACGAAGACTGGCTCCAGCGGACCAGCATCCTCATC
CCCTTTCCGCCCCAGCTGTACGCCAAGATGCCTGTCTTCCTCAAGCGCACCATCTTCCTCGAGTTCCCCATGTAC
GTCTTCGACCCTGCCAAACACTCGGAGCACTCTTTTCCGGGCGGCGCTTCCGAGACGGCCGATGAGCGGGGACGA
CATGGTGGCGACGAGAGGCTGGCCTAA
Gene >Ophun1|4835
ATGGCAACCGTCCACGTCCTGGACAATTACTACCTCGCCATCACCGCCCTCGTAACCATAGCCTACCAACTCCTC
TTCTTCTCCATCGCCTACACCTTCAAGTTCGACAAGCTAACCGGTAACCCTCCCCCTCTCCCTCCCCCCCATTCA
AACAAGAAATCTCACCCGCCCAGACCTCGCCGGCGGCTCCAACTTCGCCGTCCTCGCCATCCTCACCCTCTCCCT
CTCGGGCCAACATCATGCCCGCCAGGTCGTAGCCTCCCTCTTCCTCATCATCTGGGCCGTCCGCCTCTCCGGCTT
CCTCTTCTTCCGCATCCTCAAAACCGGCTCCGATGACCGCTTCGATGACAAGCGCGACAAGTTCTTCCCGTTTCT
TGGCTTCTGGATCTTTCAGATGCTCTGGGTTTGGACCGTCTCTTTGCCCGTTACTGTCCTCAACTCGCCCAACGT
GACGCAGTATCCGCAGCATTCCTTTGGTACGGGCAGGGATATCGCAGGCATTGTCCTCTTTGTCATCGGCTTTCT
CATGGAGGCTGTCAGCGACGTGCAAAAGTATCGCTTCCGTCAGTCTCACGACAAGAGATCCGTCTGCAACAAGGG
CCTCTTTGCCGTCTCGCGCCATCCCAACTACTTTGGCGAAATCATCATTCAATTCTGTGAGGTCTACGGTTGTTC
TTCCTCACGCACAATGCCTAACATGAGATATCACTAGCCATCTACATGATTGCCGTCTCCTCCGCCGCCGACGGC
TACGTCAGCGGTCAAGCCTACAAGGCCCTCTACGCCACCATCCTGGGCCCCTTCTTCCTCACCATCCTTCTCATG
TTCGTCTCCGGCCTACCGCTGTCAGAGCGGCCCAAGGCCAAATCACGGTACGAAAAGGGCAACAACTGGTTCGAG
TACGAAGACTGGCTCCAGCGGACCAGCATCCTCATCCCCTTTCCGCCCCAGCTGTACGCCAAGATGCCTGTCTTC
CTCAAGCGCACCATCTTCCTCGAGTTCCCCATGTACGTCTTCGACCCTGCCAAACACTCGGAGCACTCTTTTCCG
GGCGGCGCTTCCGAGACGGCCGATGAGCGGGGACGACATGGTGGCGACGAGAGGCTGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail